(data stored in ACNUC7421 zone)

EMBL: CP001700.PE250

CP001700.PE250       Location/Qualifiers
FT   CDS_pept        complement(283076..284329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0252"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: sgr:SGR_4463 M20/M25/M40 family peptidase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69205"
FT                   /db_xref="GOA:C7QJ63"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ63"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ACU69205.1"
FT                   /translation="MSLFSVHRAVDEAEASAYSDMWRSLLPLGLNSDTGGYRRFAWNTA
FT                   DLACRDWFRSEAAARGLEVETDRNGNLWAWWGPKGPGAIVTGSHLDSVPDGGAFDGPLG
FT                   VVSSFAAVDVLRARGFTPAKPFAVACFSDEEGARFGIACAGSRLMTGALSAEKARGLCD
FT                   LDGVTMASAMEQAGQDPATLGRDDERLEGIAAYVELHVEQGKALAFTESPVAVASAIWP
FT                   HSRWRFEFAGEANHAGTTRLEDRRDPMLTYANAVLAARKKAKLGGAVATFGRLVVEPNG
FT                   TNAIPSRVRAWLDVRAPADEILAAVTEEIIKAADERAGRDGTVLSTERESHTPVVEFDD
FT                   VLRNRLAGSLRQTFGAVPVLPTGAGHDAGILAAAVPTAMLYVRNPTGVSHAPGEHADDR
FT                   DCLAGVTALADVLQELCQ"
     gtgtccttgt tctctgtcca cagggctgtg gacgaggcgg aggcgagtgc ctacagcgac        60
     atgtggcgct cgcttctgcc cctcggcctg aactccgaca ccggcggcta ccgccgtttc       120
     gcttggaaca ccgcggatct ggcgtgccgc gactggttcc gctccgaggc cgccgcgcgc       180
     ggcttggagg tggagaccga ccgcaacggc aacctgtggg cgtggtgggg accgaagggt       240
     cccggcgcga tcgtcaccgg ttcgcacttg gactcggtgc ccgacggcgg tgctttcgac       300
     gggccgctcg gcgtggtgtc gtcgttcgcg gcggtcgacg tgttgcgtgc tcgcggattc       360
     actccggcca agcctttcgc agtggcctgt ttctcggacg aggaaggcgc gcgattcggt       420
     attgcctgcg cggggtctcg cttgatgacg ggcgcgctgt ccgctgagaa ggcgcgcggt       480
     ctgtgcgatc tggacggcgt cacgatggcg tcggcgatgg agcaggcggg acaggaccct       540
     gcgacgctcg ggcgcgacga cgagcggttg gaaggcatcg ccgcctacgt cgagctgcac       600
     gtcgagcagg gcaaggcgct ggccttcacc gagtcgccgg tcgcggtggc ctcggcgatc       660
     tggccgcaca gccgctggcg cttcgagttc gccggcgagg ccaaccacgc cgggaccacc       720
     cggctggagg atcggcgcga cccgatgctc acgtatgcca acgcggtgct ggcagcccgg       780
     aagaaggcga agctcggcgg ggcggttgcg acgttcgggc gactggtcgt cgagcccaac       840
     ggcacgaacg ccatcccttc gcgagtgcgc gcctggctgg acgttcgggc cccggccgat       900
     gagatcctgg cagccgtgac cgaggagatc atcaaagccg ccgacgagcg ggccggccgg       960
     gacggcacgg ttctgagcac cgaaagggag tcgcacacgc cggtcgtgga attcgacgac      1020
     gttttgagga accgtctggc gggcagtctt cgtcaaacgt tcggcgccgt ccccgtgctg      1080
     ccgactggtg cggggcacga cgccggaatc ctggcggcgg ccgtaccgac cgcgatgctg      1140
     tacgtccgca accccaccgg cgtgtcccac gcgcccggcg agcacgcgga cgaccgcgac      1200
     tgcctggccg gggtgaccgc actcgccgac gtgttgcagg agctgtgcca gtga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page