(data stored in ACNUC7421 zone)

EMBL: CP001700.PE251

CP001700.PE251       Location/Qualifiers
FT   CDS_pept        complement(284332..286002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0253"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: sco:SCO3073 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69206"
FT                   /db_xref="GOA:C7QJ64"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ64"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACU69206.1"
FT                   /translation="MTATSGPRPVRAARGTSITAQGWQQEAALRMLMNNLDPEVAEHPD
FT                   ELVVYGGTGKAARNWPSFDAMVRTLQTLKNDETMLVQSGKPVGVMQTHEWAPRVLLANS
FT                   NLVGDWANWEEFRRLDALGLTMYGQMTAGSWIYIGTQGILQGTYETFAAVAAKKFNDTL
FT                   AGTITLTAGLGGMGGAQPLAVTMNGGVAICVDCDERSIDRRVEHRYLDVKANSLDHALQ
FT                   LATEARDKREALSIGVLGNAAELVPRLLAMDAPIDIVTDQTSAHDPLAYLPLGMDFHDM
FT                   KQFAKDKPAEFTQRARESMAKHVEAMVGFQDKGAEVFDYGNSIRGEAQLAGYTRAFDFP
FT                   GFVPAYIRPLFCEGKGPFRWAALSGEASDIAKTDKAILELFPENESLARWIKMAGERVH
FT                   FQGLPARICWLGYGERDKAGARFNDMVADGTLAAPIVIGRDHLDAGSVASPYRETEAMA
FT                   DGSDAIADWPLLNAMVNVASGASWVSIHHGGGVGMGRSIHAGQVTVADGTKLAGEKVRR
FT                   VLTNDPGMGVIRHVDAGYDRADEVADERGVRVPMREGDA"
     atgaccgcga ccagtggtcc gcgcccggtc cgcgccgccc gcggcacgag catcaccgcg        60
     cagggctggc agcaggaagc cgctctgcgg atgctgatga acaacctcga cccggaggtc       120
     gccgagcacc ccgacgaact ggtcgtctac ggcggcaccg gcaaggcggc gcgcaactgg       180
     ccgtccttcg acgcgatggt gcgcaccctg cagacgctga agaacgacga gacgatgctg       240
     gtgcagtccg gcaagccggt cggcgtcatg cagacccacg agtgggcgcc gcgcgttctg       300
     ctcgccaact ccaacctggt cggcgactgg gcgaactggg aggagttccg gcgcctggac       360
     gccttgggcc tgaccatgta cgggcagatg accgccggct cctggatcta catcggcacg       420
     cagggcatct tgcagggtac gtacgagacg ttcgccgcag tcgccgccaa gaagttcaac       480
     gacaccctgg ccgggaccat caccctgacc gcgggtctgg gcggcatggg cggcgcgcag       540
     ccgctggccg tcaccatgaa cggcggcgtg gcgatctgcg tcgactgcga cgagcgctcc       600
     atcgaccgcc gcgtcgagca ccgctacctg gatgtgaagg cgaactcgct ggaccacgcg       660
     ctgcagttgg ccactgaggc ccgcgacaag cgcgaggcgc tgtcgatcgg cgtcctgggc       720
     aacgccgccg agctggtccc gcggctgctg gcgatggacg cgccgatcga catcgtcacc       780
     gaccagacct cggcgcacga cccgctggcg tacctgccgc tgggcatgga cttccacgac       840
     atgaagcagt tcgcgaagga caagccggcc gagttcacgc agcgggcgcg cgaatcgatg       900
     gccaagcacg tcgaggcgat ggtcggcttc caggacaagg gcgccgaggt cttcgactac       960
     ggcaactcca tccgcggcga ggcgcagctg gccggataca cgcgcgcctt cgacttcccc      1020
     ggcttcgtgc cggcgtatat ccgtcccctg ttctgcgagg gcaagggccc gttccgctgg      1080
     gccgcgctgt cgggtgaggc atccgacatc gcgaagacgg acaaggcgat tctggagctg      1140
     ttcccggaga acgagtcgct ggcgcgctgg atcaagatgg ccggcgagcg cgtgcacttc      1200
     cagggtctgc cggcgcgcat ctgctggctc ggctacggcg agcgcgacaa ggccggcgcg      1260
     cgtttcaacg acatggtcgc cgacggcacg ctggccgcgc cgatcgtcat cgggcgcgac      1320
     cacctggacg ccgggtccgt ggcctcgccg taccgcgaga ccgaggcgat ggccgacggc      1380
     tccgacgcga tcgcggactg gccgctgctg aacgcgatgg tgaacgtcgc ctccggcgcc      1440
     tcgtgggtgt cgatccacca cggcggcggc gtcggcatgg gccgctcgat ccacgccggg      1500
     caggtgaccg tcgccgacgg cacgaagctg gccggggaga aggtccgcag ggttctgacc      1560
     aacgacccgg gcatgggggt gatccggcac gtggacgccg ggtacgaccg tgccgacgag      1620
     gtcgccgacg agcgtggtgt acgcgtgccg atgcgtgaag gtgacgcgta a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page