(data stored in ACNUC7421 zone)

EMBL: CP001700.PE252

CP001700.PE252       Location/Qualifiers
FT   CDS_pept        286093..287646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0254"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: sma:SAV_3325 histidine ammonia-lyase; TIGRFAM:
FT                   histidine ammonia-lyase; PFAM: phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69207"
FT                   /db_xref="GOA:C7QJ65"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ65"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACU69207.1"
FT                   /translation="MSQVVVIGEADLTFGDVVAVARDGARVELSATSLKALAEGRAVVD
FT                   RLAAAPTPAYGISTGFGALATRHIDPEMRAQLQRSLIRSHAAGMGPLVEPEVIRALTLM
FT                   RLKTLATGHTGVRPVVAETMAALLNSGVTPAVREYGSLGCSGDLAPLSHVALVLMGEGE
FT                   VVGADGVSAVAAGPVLAEHGIEPLELAPKEGLALINGTDGMLGMLILALGDLTELVKVA
FT                   DISAAMSVEALLGTDKVFRPELQAIRPHPGQAASAANLVKVLDGSPIMESHREPNECTR
FT                   VQDAYSLRCAPQVAGATRDTMAHAATVAERELASIVDNPVVLLADGRVESNGNFHGAPV
FT                   AMVLDFLAIAAADLGSIAERRTDRMLDVARSHGLPPFLADDPGVDSGLMIAQYTQAALV
FT                   SENKRLAVPASVDSIPSSAMQEDHVSMGWSAARKLRTAVDNLRRILAVELVAAARALEL
FT                   RAPLQPAAGTGAAVRALREAGVGGPGPDRFLSPELRAAEDALKSGAVVAAVETAVGPLN
FT                   "
     atgagccagg tagtggtgat cggtgaggcg gatctcactt tcggtgacgt tgtcgccgtg        60
     gcccgggacg gtgcccgcgt cgaattgtcc gcgacgtcgc tgaaggcgct ggccgagggg       120
     cgcgccgtgg tggaccggct ggccgccgcg ccgaccccgg cctacggcat ctccaccggc       180
     ttcggcgcgc tggccacccg gcacatcgat ccggagatgc gcgcgcagct gcagcgctcc       240
     ctgatccgct cgcacgccgc cggcatgggc ccgctggtcg agcccgaggt gatccgcgcg       300
     ctcaccctca tgcggctgaa gacgctggcc accgggcaca ccggcgtgcg ccccgtggtc       360
     gccgagacca tggccgcgct gctgaactcc ggcgtcaccc cggccgtgcg cgagtacggc       420
     tcgctgggct gttccggcga cctggcgccg ctgtcgcacg tcgccctggt gctcatgggc       480
     gagggcgagg ttgtcggggc ggacggggtt tctgcggtcg ccgcaggacc ggtcctggcc       540
     gagcacggca tcgagccgct ggagctggcg cccaaggagg gcctggcgct gatcaacggc       600
     accgacggca tgctcggcat gctgatcctg gctcttggcg acctgaccga gctggtgaag       660
     gtcgcggaca tctccgcggc gatgtcggtc gaggcgctgc tgggcacgga caaggtgttc       720
     cgccccgaac tgcaggccat ccgcccgcat ccgggtcagg ccgcttccgc cgcgaacctg       780
     gtgaaggtgc tcgacggctc gccgatcatg gagtcgcacc gcgagcccaa cgagtgcacc       840
     cgcgtccagg acgcctactc gctgcgctgc gccccgcagg tcgccggcgc cacgcgggac       900
     accatggcgc acgccgcgac ggtcgccgag cgcgaactcg cctcgatcgt cgacaacccg       960
     gtggtgctgc tggccgacgg ccgcgtggag tccaacggca acttccacgg cgccccggtc      1020
     gcgatggtcc tggacttcct cgccatcgcc gccgccgacc tcggctccat cgccgagcgc      1080
     cgcaccgacc gcatgctcga cgtcgcgcgc tcgcacggcc tgccgccgtt cctcgccgac      1140
     gacccgggcg tcgacagcgg cctgatgatc gcgcagtaca cgcaggccgc tttggtcagc      1200
     gagaacaagc ggctggcggt cccggcgtcg gtggactcga tcccgtcctc ggcgatgcag      1260
     gaggaccacg tctccatggg ctggtcggcg gcgcgcaagc tgcgcaccgc cgtggacaac      1320
     ctgcggcgca tcctggccgt cgagctggtc gccgccgcgc gggcgctgga actgcgcgcg      1380
     ccgctgcagc ccgccgccgg gaccggcgcg gctgtcaggg ccctgcggga ggccggcgtc      1440
     ggcggcccgg gcccggaccg cttcctgtcg ccggagctgc gcgccgccga ggacgcgctg      1500
     aagtccggcg cggtggtcgc ggccgtcgag acggccgtgg gtccgctgaa ctga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page