(data stored in ACNUC7421 zone)

EMBL: CP001700.PE253

CP001700.PE253       Location/Qualifiers
FT   CDS_pept        complement(287731..288150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69208"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69208.1"
FT                   /translation="MAARGWNRQYITQVHIEEPLAGTCGNSLGPETDQNDVWDARYPST
FT                   NGRDYADQQVHTYVSAAYAASRVAASDPKCSGVTARTAGGFAWHGTAREGIQHVLFVRL
FT                   NNKVSTLVITVDGHDYDSALDTALLQTMAQRLANS"
     gtggccgccc gcggctggaa tcgccaatac atcacgcagg ttcacatcga ggaaccgctt        60
     gcggggacct gcggcaactc gctgggaccc gagaccgatc agaacgacgt ctgggacgcg       120
     cgctacccgt ccacgaacgg ccgggattac gccgatcagc aagtccacac ctacgtttcg       180
     gcggcctacg cggcatcccg tgtcgcggcg tccgatccga agtgcagcgg cgtcacagcc       240
     cggaccgccg gcgggttcgc ctggcacggc acggctcgcg aaggaatcca gcacgtcctg       300
     ttcgtccgct tgaacaacaa ggtctccacc ctcgtcatca ccgtcgacgg ccacgactac       360
     gactccgcgc tcgacaccgc gcttctgcaa acgatggctc agcggctcgc gaactcataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page