(data stored in ACNUC7421 zone)

EMBL: CP001700.PE254

CP001700.PE254       Location/Qualifiers
FT   CDS_pept        288182..288544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69209"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69209.1"
FT                   /translation="MVVDGGAEGVGDASSVGGGELSVVEAVVEPEADADFEVDVEAAPL
FT                   LVLLLVLVLVAGFAGDADELLLPHAPRAALSAIAHPAATTVRILTVSGIEFPVLHWSQD
FT                   GWWTFHLARGLPARAG"
     ttggtcgtcg acggcggggc cgagggtgtc ggggacgcgt catcggtcgg cgggggagag        60
     ctgtcggtcg tcgaagcggt cgtcgaaccg gaggccgacg cggacttcga agtggacgtg       120
     gaagcagcgc cactgctggt actgctgctc gtgctcgtgc tggtggcggg cttcgccggc       180
     gacgccgacg agctgctgct cccacacgcg ccgagggccg cgctcagcgc tatcgcgcac       240
     cccgccgcga cgaccgttcg gattctgact gtctcaggca tcgaattccc cgttctgcat       300
     tggagccagg acggatggtg gacgtttcac ctcgcgcgag ggttgccagc ccgggcgggg       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page