(data stored in ACNUC7421 zone)

EMBL: CP001700.PE255

CP001700.PE255       Location/Qualifiers
FT   CDS_pept        288652..289038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69210"
FT                   /db_xref="GOA:C7QJ68"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69210.1"
FT                   /translation="MASQTARHKMAICFVGSAIVLVGWMVFLANTLHGAATVSHWSTVW
FT                   IGLDTMEALALATLGILLVRHDHRARTAATVAATLFGMDAWFDVMLSQGGDFAQALVLA
FT                   VVFEIPLAAACAGIARQTARWYDV"
     atggcgtccc agacggcccg ccacaagatg gcgatctgct tcgtcggctc ggcgatcgtg        60
     ctcgtcggct ggatggtctt cctggccaac acgttgcacg gggcggcgac ggtgagccac       120
     tggtcgaccg tgtggatcgg cctggacacc atggaggcgc tggcgctggc cacgctcggc       180
     atcctgctgg tccggcacga ccaccgggcc cgcaccgccg ccacggtcgc cgcgacgctg       240
     ttcggcatgg acgcctggtt cgacgtgatg ctgtcccagg gcggcgactt cgcgcaggcg       300
     ctggtgctgg ccgtggtctt cgagataccg ctggcggcgg cgtgcgcggg gatcgctcgc       360
     cagaccgcgc ggtggtacga cgtgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page