(data stored in ACNUC7421 zone)

EMBL: CP001700.PE256

CP001700.PE256       Location/Qualifiers
FT   CDS_pept        complement(289052..290407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0258"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: stp:Strop_2409 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69211"
FT                   /db_xref="GOA:C7QJ69"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ69"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69211.1"
FT                   /translation="MAGKLPSRFSRIWSASAVSALGDGVYFAAVPLLALTLTRNPIMLG
FT                   AMEACALLPWLFFGMLGGALVDRWDRRRTMVIADLCRFSLLVLVTALIAAGAVDIYFLF
FT                   VVVFLLGIGQVFFDTASVAFLPEVLDRDLDTLQVANSRLQGAQQAFGGFVGPPVGSLLF
FT                   GLGRAVPILGDAVSFLFSSLTIWSLPKSAPKPAKPRGSLLREAREGAAFLFGNRLLVGL
FT                   SLRPAVGNFAFLGASAVLVLYVKETLHLGTTAYGIYLTANAIGALGGSAVAPRLAGKLG
FT                   TGGTLTLTAVVEAVSLLGIGLSPNAWTAGIGEMVLGAAMGATMGLGPAVRQAIVPDHLM
FT                   GRVAATGRLIALCAGPVGALFGGWLANVAGLRAPFIAGAGILAVMAVVAARLTSNTRIE
FT                   AALAEAAGRRERETSQEQEQEQGQGQDRGQKQAQAVEQAVEANVAADAVAMA"
     atggctggca aactcccctc gcgcttctcc cgcatatgga gcgcctccgc ggtctccgcg        60
     ctcggcgacg gcgtctactt cgccgcggta ccgctgctcg cgctgaccct gacccgcaac       120
     ccgatcatgc tcggcgcgat ggaagcgtgc gcgctgttgc cgtggctgtt cttcggcatg       180
     ctcggcgggg cgctggtcga ccggtgggat cggcggcgca cgatggtgat cgccgacctg       240
     tgccggttct cgctgctggt cttggtgacc gcgttgatcg ccgccggcgc cgtcgacatc       300
     tacttcctgt tcgtggtcgt gttcctgctg gggatcggcc aggtcttctt cgacaccgcg       360
     tcggtcgcgt tcctgcccga ggtcctggac cgcgacctgg acacgttgca ggtcgccaac       420
     tcgcggcttc agggcgcgca gcaggcgttc ggcggttttg tcgggccgcc ggtcggatcg       480
     ctgctgttcg ggctggggcg ggcggtgccg attctcggcg acgcggtgtc gttcctgttc       540
     agttccctga cgatctggtc gctgcccaag tcggcgccga agcccgccaa gccgcgcggt       600
     tcgctgctgc gcgaggcgcg ggagggcgcg gcgttcctgt tcgggaaccg gctgctggtg       660
     gggttgtcgt tgcgcccggc ggtggggaac ttcgcgttcc tgggagccag cgcggtactg       720
     gtgctgtacg tgaaggagac gctgcacctc gggaccaccg cttacggcat ctacctcacg       780
     gcgaacgcca tcggcgcgct gggcgggtcg gcggtggcgc cgcggctggc gggcaagctc       840
     gggaccggcg ggacgctgac gctgaccgcg gtcgtggaag ccgtgtcgct gttggggatc       900
     gggctctcgc cgaacgcgtg gaccgcgggg atcggcgaga tggtgctcgg cgcggcgatg       960
     ggcgccacga tgggactggg accggcggtg cggcaggcga tcgtgccgga tcacctgatg      1020
     ggccgggtcg ccgcgacggg acggctgatc gccttgtgcg ccggaccggt cggcgcgttg      1080
     ttcggcgggt ggctggcgaa cgtcgccggt ctgcgggcgc cgttcatcgc cggagccggg      1140
     atcctggcgg tgatggcggt cgtcgcggca cggctgacga gcaacacgcg gatcgaggcg      1200
     gcgctggccg aggccgctgg gcgccgcgag cgggagacgt cgcaggagca ggagcaggag      1260
     cagggacagg ggcaggatcg gggacagaag caggcgcaag cggtggagca ggcagtcgag      1320
     gcaaatgtcg cggccgacgc cgtcgcaatg gcctga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page