(data stored in ACNUC7421 zone)

EMBL: CP001700.PE257

CP001700.PE257       Location/Qualifiers
FT   CDS_pept        complement(290407..290922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0259"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bcz:BCZK1497 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69212"
FT                   /db_xref="GOA:C7QJ70"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ70"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACU69212.1"
FT                   /translation="MPTDEEPDAIHIQSDEQLRAVASHTRHRILRVLRDKPATITQVAE
FT                   RLGIAKGSSNHHMKVLAKAGLVAVVETRKVGGVTEQYYAMTGRTIELPETGAGQPEMLM
FT                   RHALADIEAAPPSDQRTVFLKHARLSPEAWVEFNERLQALIGELHDASDPTQPAADLFV
FT                   AFYRPKDV"
     gtgcccaccg acgaagagcc agacgccatc cacatccaaa gcgacgagca actacgcgcc        60
     gtcgccagcc acacccgcca ccggatcctg cgcgtgctgc gggacaagcc cgccaccatc       120
     acccaggtcg ccgagcgcct gggcatcgcc aagggcagct ccaaccacca catgaaggtg       180
     ctggcgaagg ccgggctggt ggcggtcgtg gagacccgca aggtcggcgg cgtcaccgag       240
     cagtactacg cgatgaccgg acggaccatc gagctgccgg agaccggcgc cgggcagccg       300
     gagatgctga tgcgccacgc attggccgac atcgaggccg cgccgccgag cgaccagcgg       360
     acggtgttct tgaagcacgc acgcctcagc cccgaggcgt gggtggagtt caacgagcgg       420
     ctccaggctc tgatcgggga actgcacgac gcctccgatc ccacgcagcc ggccgctgac       480
     ctgttcgttg cgttctaccg accgaaggac gtctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page