(data stored in ACNUC7421 zone)

EMBL: CP001700.PE258

CP001700.PE258       Location/Qualifiers
FT   CDS_pept        complement(291017..291988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0260"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: sco:SCO0724 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69213"
FT                   /db_xref="GOA:C7QJ71"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ71"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ACU69213.1"
FT                   /translation="MTTPEPVTPTTSAEIAAPPSVTPATPAAASAASAGSRLSSTLPPA
FT                   DELLALLDGRRLSPAQRRIAHYLLENLPEVAFLSSMELAERVGVSQPSVTRFAAALGFS
FT                   GYPELRAALRPIALRVPEAGIHGERIAGNELHSALESDQANLEALHKYAADPARLSRLG
FT                   SDLAASEPLSVIGLRMSAPVASYFAYGAARIHPDVRVVHTPGSLAHEALLQAVAAGGTW
FT                   LVVFVLPRYPAESVVVLRSARELGLKTAVITDVPLVPFAHLADVLLPVGVGSRSVFDSH
FT                   AAPMAFAALLLQALADAAPERTQERLEAYEALAETRGFYVSK"
     gtgacgaccc cagagcctgt gactcctact acatcggcag agattgctgc tccgccgtct        60
     gtgactcctg ctacaccggc tgccgcctcc gccgcgtcag ccggctcacg cctctcctcc       120
     accctgccac ctgcggacga actgctggcg ctgctggacg ggcggcgcct gtcgccggca       180
     cagcggcgga tagcgcacta cctcctagag aacctccccg aggtcgcctt tctgtcgagc       240
     atggagctgg ccgaacgcgt cggcgtgagc cagccgtcgg tgaccaggtt cgcggcggcg       300
     ttgggcttct cgggttaccc ggagctgcgg gctgcgctgc gcccgatcgc actgcgcgtc       360
     cctgaggcgg gtatacacgg ggaacgcata gcggggaacg agctgcattc cgctctagag       420
     agcgaccagg cgaacctgga agcgctccac aagtacgccg ccgacccggc gcgcctgtcg       480
     cgtctgggca gcgacctcgc cgcctcagaa ccgctctccg tgatcggcct aaggatgtcc       540
     gcgcctgtcg cctcctactt cgcgtatgga gccgcgcgta tccatcccga cgtacgggtg       600
     gtccacacgc cgggttcact ggcgcacgag gcactgttgc aggccgtcgc ggccggcggg       660
     acgtggctcg tcgtcttcgt gctgccgcgc tatccggccg agtccgtcgt cgtcctacgg       720
     agtgcgcggg aactcgggct caagacagcg gtgatcacgg acgtgccgct ggtgccgttc       780
     gctcatttgg cggatgtgct gctgccggtc ggcgtcggat cacgctcggt cttcgactcg       840
     cacgccgcac cgatggcctt cgccgccctc ctgctccagg ctctcgccga cgccgccccg       900
     gagcggacgc aggagcggct ggaggcgtac gaggcgctcg cggagacccg cggcttctac       960
     gtcagcaagt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page