(data stored in ACNUC7421 zone)

EMBL: CP001700.PE259

CP001700.PE259       Location/Qualifiers
FT   CDS_pept        292147..294393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0261"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: sgr:SGR_3436 putative
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69214"
FT                   /db_xref="GOA:C7QJ72"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ72"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACU69214.1"
FT                   /translation="MQLAAIVVSLVISVIGFGLLGRTAVYIYQFVKLGQSTAPGVRSNE
FT                   PLERTRNLFREFLGHTRLARKGKRWIGAMHWVVMVGFGLLFFTLVTAYGQLFSADFAIP
FT                   LIGRWWPFEFVTEVISFVMILAIAALIGIRLRNRPAGAGSKEKGKRSRFFGSTMWQAYF
FT                   VEGVILGIGLCIMLLRGFEGALGGHLSYSAHYPVSYPLVHAFDGMSRGSLENWIYAIAA
FT                   VKIVISMAWAITIGLNSTMSVAWHRFLAFPNIWFKKKADGGTALGALSPMASGGVPIDF
FT                   EDPAEDARFGVGAVEDFTWKGLLDFSTCTECGRCQDQCPAWNTDKPLSPKLLMLALRDH
FT                   SAAKAPYLFAGGGKDLEGNEKLAEEKWLSLPDMVRAEAERPLIGTAEENGVIDPDILWS
FT                   CTTCGACVEQCPVDIEHVDHIVDMRRYQVMIESSFPSEAGTMLKNLEKAQNPWGMQPKK
FT                   RTEWIQELDFEVPVFGETLEDISEVEYLYWVGCAGSLEDRAKKTTKAFAELLHIAGVKF
FT                   AVLGGMESCTGDPARRLGNEFLFQMLGQGNVEMLNEVFGEDTPREKRKIVATCPHCFNS
FT                   LANEYPQLGGEYDVIHHTQLLDTLVSEGKLTPVTPIDQNITYHDPCYLGRHNKVYTPPR
FT                   EIIAKVPGLKNTEMHRCKEKGFCCGAGGARMWMEERIGKRINVERVDEALSTNPDVIST
FT                   ACPYCLVMLGDSITARKQAGEVPESMEVVDVAQLLLTSVKPAPASSAEPAAANA"
     atgcagctcg cagccatcgt cgtctcgctg gtgatctcag tcatcggctt cggtctgctg        60
     ggccggaccg ccgtctatat ctaccagttc gtgaagctcg gccagtcgac cgcgccgggg       120
     gtgcgcagca acgagccgtt ggagcggacc cggaacctct tccgggagtt cctgggccac       180
     acccggctgg cgcgcaaggg caagcgctgg atcggcgcca tgcactgggt ggtcatggtc       240
     ggcttcggcc tgctgttctt caccctggtc accgcctacg gccagctgtt ctcggcggac       300
     ttcgcgatcc cgctgatcgg gcgctggtgg cccttcgagt tcgtcaccga agtgatcagc       360
     ttcgtgatga tcctggccat cgccgcgctg atcggcatcc gcctgcgcaa ccgccccgcc       420
     ggtgccggct ccaaggagaa gggcaagcgc tcgcgcttct tcggctccac gatgtggcag       480
     gcctacttcg tcgagggagt catcctcggc atcgggctgt gcatcatgct gctgcgcggc       540
     ttcgagggcg cactcggcgg ccacctctcc tacagcgcgc actacccggt cagctacccg       600
     ctggtccacg ccttcgacgg catgtcgcgc ggctcgctgg agaactggat ctacgcgatc       660
     gccgcggtca agatcgtcat ctccatggcc tgggccatca ccatcggctt gaactccacg       720
     atgagcgtgg catggcaccg gttcctggcg ttccccaaca tctggttcaa gaagaaggcc       780
     gacggcggca ccgcgctcgg cgcgctgagc ccgatggcct ccggcggcgt gccgatcgac       840
     ttcgaggacc cggccgagga cgccaggttc ggcgtcgggg cggtcgagga cttcacgtgg       900
     aagggcctgc tggacttctc gacctgcacc gagtgcggcc gctgccagga ccagtgcccg       960
     gcgtggaaca ccgacaagcc gctgtccccg aagctgctga tgctcgccct gcgcgaccac      1020
     tccgcggcca aggcgccgta cctgttcgcc ggcggcggca aggacctcga gggcaacgag      1080
     aagctggccg aggagaagtg gctctcgctg ccggacatgg tccgcgccga ggctgagcgc      1140
     ccgctgatcg gcaccgctga agagaacggc gtcatcgacc cggacattct gtggtcctgc      1200
     accacctgtg gcgcttgtgt cgagcagtgc ccggtggaca tcgagcacgt ggaccacatc      1260
     gtcgacatgc gccgctacca ggtgatgatc gagtcctcgt tcccgtccga ggcgggcacg      1320
     atgctgaaga acctggagaa ggcacagaac ccttggggta tgcagcccaa gaagcgcacc      1380
     gagtggatcc aggagctgga cttcgaagtc ccggtgttcg gcgagactct ggaggacatc      1440
     tccgaggtcg agtacctcta ctgggtcggc tgcgccggct cgctggagga ccgcgcgaag      1500
     aagaccacga aggcgttcgc cgagctgctg cacatcgccg gtgtgaagtt cgcggttctg      1560
     ggcggcatgg agtcctgcac cggtgacccg gcgcggcgac tgggcaacga gttcctgttc      1620
     cagatgctgg ggcagggcaa cgtcgagatg ctgaacgagg tcttcggcga agacaccccg      1680
     cgcgagaagc gcaagatcgt cgcgacctgc ccgcactgct tcaactcgct ggccaacgag      1740
     tacccgcagc tcggcggcga gtacgacgtc atccaccaca cgcagctgct ggacaccctg      1800
     gtctccgagg gcaagctgac cccggtgacg ccgatcgacc agaacatcac ctaccacgac      1860
     ccgtgctacc tgggccgcca caacaaggtc tacaccccgc cgcgcgaaat catcgccaag      1920
     gtgcccggcc tgaagaacac cgagatgcac cgctgcaagg agaagggctt ctgctgcggc      1980
     gccggcggcg cgcgcatgtg gatggaggag cgcatcggca agcggatcaa cgtcgagcgc      2040
     gtggacgagg cactgtccac caaccccgac gtgatctcca cggcgtgccc ctactgcctg      2100
     gtcatgctcg gcgactcgat caccgcgcgc aagcaggccg gcgaggtccc ggagtcgatg      2160
     gaggtggtcg acgtcgcgca gctgctgctg acgtcggtga agcccgcgcc ggccagcagc      2220
     gcggaaccgg ctgccgccaa cgcctga                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page