(data stored in ACNUC7421 zone)

EMBL: CP001700.PE26

CP001700.PE26        Location/Qualifiers
FT   CDS_pept        27626..28087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0026"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: sma:SAV_2662
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68981"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP2"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU68981.1"
FT                   /translation="MSTRVVTPGVVTPEAEERALGMAYDVVYDVLQAPCPSRQALEHVT
FT                   GRWGALIMMALREGPVRFNELRRRVDGVSEKMLSQGLQALERDGFVAREVQSTMPPKVE
FT                   YQLTPLGTQTSDRLADLVEFLEGRMPEVEAAQARHDEAASAAASVSASA"
     atgagtacgc gcgtcgtgac acccggagtc gtgacccccg aagcggaaga gcgcgccctc        60
     ggcatggcct acgacgtcgt ctatgacgtc ctgcaggcgc cgtgtccgtc gcgtcaggcg       120
     ctcgagcacg tgaccggccg ctggggtgcg ctgatcatga tggctctgcg ggaagggccg       180
     gtccggttca acgagctgcg ccgccgcgtc gacggcgtga gcgagaagat gctgtcccaa       240
     gggcttcaag ccttggagcg ggacggtttc gtggcccgcg aggtgcagtc cacgatgccg       300
     ccgaaggtcg agtaccagct gacgccgctc ggtacgcaga cctcggaccg gctggcggac       360
     ctggtggagt tcctggaggg ccggatgccg gaggtcgagg ccgcgcaggc ccgccatgat       420
     gaggccgcct ccgccgccgc ctcggtgtcc gcttccgcgt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page