(data stored in ACNUC7421 zone)

EMBL: CP001700.PE260

CP001700.PE260       Location/Qualifiers
FT   CDS_pept        294505..295530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5144 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69215"
FT                   /db_xref="GOA:C7QJ73"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69215.1"
FT                   /translation="MSFDEPDGYRDDLGRTRDDGSRYPASGSPDSEYGDDDDYDDSDPG
FT                   DEPTAPLPTRGRPVVPPEPPSEWRKRGSRVWRFTRTLLITVLVLVGLAAVGNVLINRYP
FT                   RISKHTYTYTNVQRMLIAVDGNGSINVTGSDTDQVTIKATDRATLLDPVERQIISAGGY
FT                   LLVSVHCPNSECSSKYTIQVPRSMSVEAMMDHSSDQADISATGLDAAVQLFTGRGNVTV
FT                   NHLATTSDVSVTANGQVVANDVSAANLDVFAPIGDKIDLQVSGDISNIQNIRVTAGQPA
FT                   EVTLKVPAGGYRFACVPAGHCTGANGDITQDEASPVHEDQTSTHNIQVNVVQNTAKIQA
FT                   N"
     gtgtctttcg acgagccgga cggctaccgg gacgacctgg gccggacgcg tgacgacgga        60
     tcgcggtatc cggcttcggg gtcgcctgac tccgagtacg gcgacgacga tgattacgac       120
     gattccgatc ccggcgacga accgaccgcg ccgctgccga cccgcgggcg gccggtcgtg       180
     ccgccggaac cgccgtcgga gtggcgcaag cggggttcgc gggtctggcg tttcacccgc       240
     acgctgctga tcacggtgct ggtcctggtc gggctggcgg cggtcgggaa cgtgctgatc       300
     aaccgctacc cgcgcatcag caagcacacg tatacgtaca cgaacgtgca gcggatgctg       360
     atagccgtgg acggcaacgg ctcgatcaac gtcaccggct cggacaccga tcaggtgacc       420
     atcaaggcga ccgaccgggc gaccctgctg gacccggtgg agcgccagat catcagcgcc       480
     ggcggctatc tgctggtgag cgtgcactgc ccgaacagcg agtgctcctc gaagtacacc       540
     atccaggtcc cgcgctcgat gtcggtcgag gcgatgatgg accactccag cgaccaggcg       600
     gacatcagcg ccaccggact ggacgcggcg gtgcagctgt tcaccgggcg cggcaacgtc       660
     acggtgaacc atctggccac cacctccgac gtgagcgtga cggccaacgg ccaggtcgtg       720
     gcgaacgacg tgagcgcggc gaacctggac gtcttcgccc cgatcgggga caagatcgac       780
     ctgcaggtga gcggcgacat ctcgaacatc cagaacatcc gcgtcacggc cgggcagccg       840
     gccgaggtga cgctgaaggt gccggccggc gggtaccggt tcgcgtgcgt gcccgccggg       900
     cactgcaccg gcgccaacgg ggacatcacg caggatgagg cgagtccggt gcacgaggat       960
     cagacgtcga cgcacaacat ccaggtgaac gtggtacaga acactgcgaa gatccaggcg      1020
     aactga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page