(data stored in ACNUC7421 zone)

EMBL: CP001700.PE262

CP001700.PE262       Location/Qualifiers
FT   CDS_pept        296375..297319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0264"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL0518 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69217"
FT                   /db_xref="GOA:C7QJ75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ75"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU69217.1"
FT                   /translation="MRANQRNQPVTGINVLRWELGSELRTLRLAAGKSIADAARHLECS
FT                   DAKISRMENGQRGAVARDVRDLCKLYGVPAQRRDQLISLSREAVDADKGTTPIPAKYST
FT                   FIALESQARSLRNYEMTFVPGLLQTERYAWETITRNGDSRDEADVERLVQIRMDRQKRI
FT                   WNDSSLKAHFVIDENVLWRPAGVDGRTRAIREEQIDRLIRATGLDHVTLQVIPYVAGFY
FT                   QGMEGATIHLLNLDDGPKTGSACYIEGVFRELFVRGHGEIADIGAKFAAMADTALSALD
FT                   TRKFLMRLLKGNYEHWSSARPQGSSGLGKVAMS"
     gtgcgagcca atcagcggaa ccagcccgtg accggaatca acgtcctgcg ctgggaactc        60
     ggcagcgagc tgcgcaccct ccgcctcgcc gcgggcaaga gcatcgccga cgcggcccgg       120
     cacctggagt gctcagacgc gaagataagc cgcatggaga acggccagcg cggcgccgtg       180
     gcacgagacg tgcgagacct gtgcaaactg tacggagtgc cagctcagag gcgggatcag       240
     ctgatctcgc tgagccggga ggctgtcgac gccgacaagg gaacgacccc catcccggcc       300
     aagtactcga ccttcatcgc gctcgagtcc caggctcgga gccttcgcaa ctacgagatg       360
     acctttgtcc cgggactgct tcagacagag cggtacgcct gggagacgat cacgcgcaac       420
     ggggacagcc gtgatgaggc cgacgtcgaa agactggtcc agatccgtat ggaccgacag       480
     aaaaggatct ggaacgacag ctcgctcaaa gcccacttcg tcatcgatga gaacgtgctc       540
     tggcgtccgg cgggggtcga tgggaggacc cgtgccatcc gcgaggaaca gatcgaccgt       600
     ctcatccgcg cgacgggcct ggatcatgtg acccttcagg tgatccctta cgtggcgggc       660
     ttctaccagg gcatggaggg cgccaccatc catctcctga atctcgatga cggtcccaag       720
     accgggagcg cctgctacat cgaaggcgtg ttccgcgagc tgttcgtgcg cggccacggc       780
     gagatcgccg acatcggcgc gaaattcgcc gccatggccg acacggcact gagcgcgctg       840
     gacacccgaa aatttctgat gcgtctgctc aaggggaatt acgaacactg gtcctccgcg       900
     cggccacagg ggtcgtccgg cttagggaag gtagcaatgt catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page