(data stored in ACNUC7421 zone)

EMBL: CP001700.PE263

CP001700.PE263       Location/Qualifiers
FT   CDS_pept        297316..297522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0265"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   sen:SACE_6608 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69218"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ76"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU69218.1"
FT                   /translation="MIGNDGLQWRKAAASSGNGSCVELAPGLAGSVYMRDSKDPQGPVL
FT                   TFTRKEIAAFLEGARGGEFDDLA"
     atgatcggaa acgacggcct gcaatggcgc aaggccgccg cgagcagcgg gaacgggtcc        60
     tgcgtggagt tagctcccgg cctcgctggt tctgtctata tgcgggactc gaaggatcct       120
     caaggacctg tactgacttt cacccgtaag gagatcgctg cgttcttgga gggagcccgg       180
     ggcggagagt tcgacgatct ggcttga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page