(data stored in ACNUC7421 zone)

EMBL: CP001700.PE265

CP001700.PE265       Location/Qualifiers
FT   CDS_pept        298052..300037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0267"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sma:SAV_2672 HSP90 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69220"
FT                   /db_xref="GOA:C7QJ78"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ78"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69220.1"
FT                   /translation="MSSEKPLVSESASAATDAGGRGLPTAHAFQVDLRGIVDLLSHHLY
FT                   SSPRVFVRELLQNAVDAITARRAVDGGAPGVVRIIADGAQVQVRDSGIGLTEDEVHRFL
FT                   ATIGRSSKRGGAGADGFGGGVGGGFGGGFGDAESVLELGRSDFLGRFGIGLLACFVVAD
FT                   EISVVTKSAVDAEAPAVEWRGASDGHYDIRILAPEETPAQPGTTVTLKPSRGKEFWFQA
FT                   PRVVELARDFGSLLPYETVLEDEAGYTYRITETPPVWDREYPSPGTRFEALAAYCQDTL
FT                   GFAPLDIIELNIPLLGIKGAAYILPTAATAATASEQGGHRVHIKGMLLTDQARGLLPDW
FT                   AFFVRCVIDTDALRPTASREALYEDDRLAAVREALGNRVRDWLAGLAATDPPRLNRLLA
FT                   VHYLGVKALARFDDDLFALTLPWLPFETTSGRLPLTAFADQHRVIHLTAGDEEFQQVSQ
FT                   IAAAVGLGVVNGGYTYDADLVRKLPRALPGVTVLDLDPETIAAHLDTVDSVEELAAGPL
FT                   LATARRVLDVQDCDVALRAYHPVTIPALLLDGRDARHERARADAESEALADGDDLWAGI
FT                   LGALRTVGPRARLVLNHRSPLIQGLIELEDAELAATGIEAVYGQALLLSKRPIRSSESA
FT                   LLNRAFLGLLGYAVGQRQEPETEEED"
     gtgtcatccg agaagccgct ggtctccgag tccgcgtccg ccgccactga tgccggtggg        60
     cgtggtctgc cgactgctca tgcctttcag gtggatctgc gggggatcgt tgatctgctg       120
     tcgcatcatc tttattcgag tccgcgggtg ttcgtgcggg agctgctgca gaacgcggtg       180
     gatgcgatca ccgctcggcg ggcggttgac gggggtgctc ccggggtggt gcggatcatc       240
     gccgacgggg cgcaggtgca ggtccgggac agtgggatcg ggctcactga ggacgaggtg       300
     caccggtttc tggccacgat cgggcgcagt tcgaagcggg gcggggcggg tgccgacggg       360
     ttcggcggcg gggtcggggg cgggttcggc ggcgggttcg gcgacgccga gagcgtgctg       420
     gagctcgggc ggagcgactt cctgggacgc ttcggtatcg gtttgctcgc gtgcttcgtg       480
     gtggccgacg agatctccgt ggtgacgaag tccgccgtgg acgcggaggc gccggcggtc       540
     gagtggcgcg gtgcgtctga cggccattac gacatcagaa tcctggctcc cgaagagact       600
     cccgcgcagc ccggtacgac cgtcaccctg aagcccagcc gcggtaagga attctggttc       660
     caggcgccgc gtgtcgtgga gctcgcccgt gacttcggca gccttctgcc ttacgagacc       720
     gtcctcgagg acgaagccgg ctacacctac cgcatcaccg agacgccgcc ggtctgggac       780
     cgcgaatacc cctccccggg cacccgcttc gaagcgctgg ccgcctactg ccaggacacc       840
     ctcggcttcg cgccgctgga catcatcgag ctcaacatcc cgctgctggg gatcaaaggc       900
     gccgcctaca tcctccccac cgcggccacc gccgccaccg cgtcggagca gggcggccac       960
     cgcgtccaca tcaagggcat gctgctcacc gaccaggcgc gcggtctgct gccggactgg      1020
     gccttcttcg tacgctgcgt catcgacacc gacgcgctgc gtcccacggc ctcgcgcgaa      1080
     gccctgtacg aggacgaccg gctggccgcc gtccgcgaag ccctcggcaa ccgcgtccgc      1140
     gactggctcg ccggcctcgc cgcgaccgac ccgccgcgcc tcaaccgcct cctggcggtc      1200
     cactacctcg gcgtcaaagc cctggctcgc ttcgacgacg acctgttcgc cctcaccctt      1260
     ccgtggctcc ccttcgagac cacgtccggc cgtctgccgc tgaccgcctt cgccgaccag      1320
     caccgcgtca tccacctgac ggccggcgac gaggagttcc agcaggtctc gcagatcgcc      1380
     gcggcggtcg ggctcggcgt ggtcaacggc ggctacacct acgacgccga cctggtccgc      1440
     aagctcccgc gcgcgctgcc cggcgtcacc gtcctggacc tggatcccga gacgatcgcc      1500
     gcgcacctgg acaccgtgga ctccgtcgag gagctcgccg ccggtccgct gctggccacc      1560
     gcccgccggg tcctggacgt ccaggactgc gacgtggccc tgcgcgccta ccacccggtc      1620
     accatccccg cgctgctcct cgacggccgc gacgcccggc acgagcgggc ccgcgcggac      1680
     gccgagagcg aggccttggc cgacggcgac gacctgtggg ccggtatcct cggcgcgctg      1740
     cggacggtcg ggccgcgggc acgcctggtc ctgaaccatc gcagcccact gatccaaggc      1800
     ctgatcgagc tggaggacgc cgaactggcc gccaccggca tcgaggccgt ctacggccag      1860
     gcactcctgc tgtccaagcg gccgatccgc tccagcgagt cggccctgct caaccgggcc      1920
     ttcctggggc tgctcggcta cgcggtcgga caacggcagg agcctgagac cgaggaagag      1980
     gactga                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page