(data stored in ACNUC7421 zone)

EMBL: CP001700.PE266

CP001700.PE266       Location/Qualifiers
FT   CDS_pept        300047..303094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_2673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69221"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ79"
FT                   /inference="similar to AA sequence:KEGG:SAV_2673"
FT                   /protein_id="ACU69221.1"
FT                   /translation="MSSTHMPSTSEPAFHQMTWTPEDLRAALEANENEPPGRARSVRAE
FT                   TLLAAADKLGDPETQICALHTVIEAYERGGESFRSPVLFSRLLRLWDRHGKTLRDASRL
FT                   EYETHWVFKWMTSDLLSVPEVPLATVTGFVDEMERRYRLAGYGMRAVHAQRFRIAEHLG
FT                   DTAQAEVHFGRWLSADRDLMSDCRACEHLTQGVWRAENGDDLAAMRLWRPTVENEISCL
FT                   DEPASTLAASLKPLLRLRRYDEARSNHLRGYRLLRGHVELRTAFGRHIEFCVLSGNGER
FT                   ALEILAENRRLFDPPYEPLDYLEFLSCVALLLRSRVDAGSTAIVAGPEGRDWPVAELLA
FT                   RVRSEIDDLSGRFDRRNGTKVVSARVAATMDQTWLVAELPLIVSQRPRPQQFQKPEQAQ
FT                   QPGQAHEPDQAPLAAVPAQREPVAEPPDPDADTDFYDLLAEARRLFNVAHPSAMKMWER
FT                   VAIAADRRGIVLDLEAQAQLAEERAAEALDREDMDRAVTLLGEAVERYKAGGLEGRAVA
FT                   VQARRLLAEALQKKTYEPIPEQALAALYATARVLQARGLAEPEDILTVRRAQAFEARRT
FT                   TEVGADTDTGTGTDRDRESAFDHFAASVEALLADAIEFDVPARAAAAHTMRAEIAQRRG
FT                   RPEESVPELLAAIALYDRAGRPWANLHPNMLLAQAYLASDRDADAERAGLAALDIAERW
FT                   PEQRFPAGYTRQVLANATGGQGRYTDSAEHALHAVGWADRHGVPDLAASARHSLAFAYE
FT                   QLGRDADAAAILESALPEMIRHLDDPTVVNARWALARCLGRLEDYRGAAEQYLLAASIA
FT                   EHFPQQGGHAMLAASAGHALRAAGLADEARRAFDRAVILLRALPDPINLAKTLRALAWV
FT                   TFGESEETAHDIEREDVLDQVLLLFAEAAQVLETAEASGAYERDAQVIAYELAETDDQL
FT                   ARLHLNADLSDKAMPYAERAAAGFRALLPHSAMDYDFSEQMVAWLLDRYGSRDAAVERL
FT                   REAIAACTEAGVEAVRCVAFLEQLGD"
     atgtcgagca cgcacatgcc cagcaccagc gagcccgcct tccaccagat gacctggacc        60
     cccgaggacc tgcgcgcggc cctggaggcg aacgagaacg agccgccggg ccgagcccga       120
     tcggtccgcg ccgagacgct gttggccgcc gccgacaagc tcggcgaccc cgagacccag       180
     atctgcgccc tgcacaccgt catcgaagcc tacgagcgcg gcggggagag cttccgctcg       240
     ccggtgctct tctcccgcct cctgcgcctg tgggaccgcc acggcaagac cctgcgcgac       300
     gcgagccgtc tggaatacga gacgcactgg gtcttcaagt ggatgacctc cgacctgctc       360
     tcggtccccg aggtcccgct ggcgacggtc accggcttcg tcgatgagat ggagcgccgc       420
     taccgcctgg ctggatacgg catgcgggcc gtccacgcgc agcgcttccg catagcggag       480
     cacctgggcg acaccgcgca ggccgaggtg cacttcggac gctggctgtc ggccgatcgc       540
     gacctgatga gcgactgccg cgcctgcgag cacctgacgc agggcgtgtg gcgggcggag       600
     aacggcgacg acctcgccgc gatgcggctg tggcggccga ccgtcgagaa cgagatctcg       660
     tgtctggacg agcccgccag cactcttgcc gcgtccctga agccactgct gcgtctgcgc       720
     cgctacgacg aagcacgctc gaatcacctg cgtggctacc gcttgctgcg cggacacgtc       780
     gagctgcgca ccgccttcgg acgccacatc gagttctgcg tgctgtctgg aaacggcgaa       840
     cgcgccctgg agatcctcgc cgagaaccgc cgcctgttcg acccgcccta cgagccgctg       900
     gactacctcg agttcctgtc ctgcgtcgcg ttgctgctgc gcagccgggt cgacgccgga       960
     tcgaccgcga tcgtcgccgg acccgaggga cgggactggc cggtcgcgga gttgctggcg      1020
     cgcgtgcgat cggagatcga cgacctctcc ggacgcttcg accgccgcaa cggcaccaag      1080
     gtcgtgagcg cgcgcgtcgc cgccacgatg gaccagacgt ggctggtcgc ggagctgccg      1140
     ctgatcgtct cgcagcgacc gcgaccccag cagttccaga agccggagca ggcgcagcag      1200
     cccggccagg cgcacgagcc ggatcaggcg ccgctggctg ccgtgcccgc ccagcgcgaa      1260
     cccgtcgccg agccgcccga cccggacgcg gacaccgact tctacgacct tctcgccgag      1320
     gcgcgccggc tgttcaacgt cgcgcacccc agcgcgatga agatgtggga acgcgtcgcg      1380
     atcgcggccg atcgccgagg catcgtgctg gaccttgagg cgcaggccca actcgccgag      1440
     gaacgcgccg ccgaagcgct cgaccgcgag gacatggacc gggccgtcac gctgctcggc      1500
     gaggctgtcg agcgctacaa ggcaggtggg ctggaagggc gcgcggtcgc ggtgcaggcg      1560
     cgcaggctgc tggccgaggc gttgcagaag aagacctacg agcccattcc ggagcaggca      1620
     ctcgccgcgc tctacgcgac agctcgagtc ctgcaagcac gcggactggc cgagccggag      1680
     gacatcctca ccgtccgccg cgcgcaggcc ttcgaagcgc gcaggacgac cgaggtcggc      1740
     gccgacaccg acaccggcac cggcaccgac cgcgaccgcg aatcagcctt cgaccacttc      1800
     gcagcaagcg tcgaagcgct cctcgccgat gccatcgagt tcgacgtccc ggcccgcgcc      1860
     gccgccgcgc acaccatgcg cgccgagatc gcccagcggc gcggtcggcc ggaggaatcg      1920
     gtcccggagc tgctggcggc catagcgctg tacgaccgcg ccgggcgtcc gtgggcgaat      1980
     ctgcacccga acatgctcct cgcgcaggcg tacctcgcct ccgaccgcga cgcagacgcc      2040
     gagcgcgccg ggctggccgc cctggacatc gccgaacgct ggcccgagca gcggttcccg      2100
     gccggataca cccgccaggt gctggccaac gcgaccggcg ggcagggccg ctacaccgac      2160
     agcgccgagc acgcgctgca tgccgtcggc tgggccgacc ggcacggcgt cccggacctg      2220
     gccgcgagcg cgcgccacag cctggcgttc gcctacgagc agctcggccg cgacgccgac      2280
     gccgccgcga tcctggaatc cgcgctgccg gagatgatcc ggcacttgga cgacccgacg      2340
     gtcgtcaacg cccgctgggc cctggcccgc tgcctcggcc gtctggagga ctaccggggc      2400
     gccgccgagc agtacctgct ggccgcgtcg atcgccgagc acttcccgca gcagggcggc      2460
     cacgcgatgc tcgcggcgtc cgccggacac gcgctgcgcg ccgccgggct cgccgacgag      2520
     gcgcgccggg cgttcgaccg cgccgtgatc ctgctgcgcg cgctgccgga cccgatcaac      2580
     ctcgccaaga ccctcagggc cctggcctgg gtgaccttcg gcgagtcgga ggagaccgcg      2640
     cacgacatcg agcgcgagga cgtcctggac caggtgctgc tcctgttcgc ggaggcggcg      2700
     caggtcctgg agaccgccga ggcctccggc gcctatgagc gcgacgccca ggtcatcgcc      2760
     tacgaactgg ccgagaccga cgaccagctg gcccgcctgc acctgaacgc ggacctgtcc      2820
     gacaaggcga tgccgtacgc cgagcgcgcg gccgccgggt tccgcgcgct gctcccgcac      2880
     agcgcgatgg actacgactt ctccgagcag atggtcgcct ggctgctgga ccggtacggc      2940
     agccgcgacg cggcggtgga gcggctgcgc gaggcgatcg ccgcgtgcac cgaggccggg      3000
     gtcgaggcgg tacggtgcgt ggcgttcctg gagcagctcg gggactga                   3048
//

If you have problems or comments...

PBIL Back to PBIL home page