(data stored in ACNUC7421 zone)

EMBL: CP001700.PE267

CP001700.PE267       Location/Qualifiers
FT   CDS_pept        303169..303735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0269"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69222"
FT                   /db_xref="GOA:C7QJ80"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ80"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69222.1"
FT                   /translation="MRGEKRDRDRDRDRDGNDRRGIEEAEFREYMVSRWGGLVRFAYGL
FT                   TGDRGHAEDLAQTALAKAYASWSRVRRADDPDAYVRRILINANHRRFRKRRVDEHAGPG
FT                   AAAREPVVTDGTAAFDQREALVAALMELPPKQRAVVVLRYWDGLTETQAATVLGCSVGT
FT                   VKSQASRALAKLRTSTQLQDGKVIS"
     atgcggggtg agaagcgtga ccgggaccgt gacagagacc gtgatgggaa cgacagacgc        60
     ggaatcgagg aagccgagtt ccgcgagtac atggtcagcc ggtggggtgg tctggtccgg       120
     ttcgcctacg gtctgaccgg cgaccgcggc cacgccgagg acctggcaca gaccgcgctg       180
     gcgaaggcgt acgcgtcctg gtccagagtg cggcgtgcgg acgacccgga cgcctacgtc       240
     cgcaggatcc tgatcaacgc caaccaccgc cgcttccgca aacgccgggt cgacgagcac       300
     gccggtcccg gcgccgcggc gcgcgagcct gtcgtcaccg acggcaccgc cgcgttcgac       360
     cagcgcgagg cactggtcgc cgcgctcatg gagctgccgc cgaaacagcg cgcggtggtc       420
     gtgctccgct actgggacgg cctgacggag acccaggccg ccacggtgct cggctgctcg       480
     gtcggcaccg tgaagagcca ggcctcgcgc gccctggcca agctccgcac cagcacacag       540
     cttcaggacg ggaaggtgat ctcgtga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page