(data stored in ACNUC7421 zone)

EMBL: CP001700.PE268

CP001700.PE268       Location/Qualifiers
FT   CDS_pept        303732..304865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1192 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69223"
FT                   /db_xref="GOA:C7QJ81"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69223.1"
FT                   /translation="MNDAYGGPDTDGEAQDGEGLFADLGHFETGAIPVDATVRQGRAIR
FT                   TRRRVIGSGMLAIAAALSIGVPVAIAGGGSSAAGAASGPDGVYAAVSSGPRITVNPTPL
FT                   VHGKGQFSGAVDGKKWSIGFDNKNCYDILWACGSQTLDPSTKYGTLGVNATVGNTDDYT
FT                   LFTQRDVASVTVVLQDGEVLHLETVPVNGTPVVLFALPPGLGVSKIVLFDGNGAQLGFS
FT                   APFTIKGSFSAQGRWYKPGETPPPAAGPVELARGTMGGDQIVMTAYTGPSGPCIVSVLG
FT                   STSNADCIHTGTITGSSIDRNGGVGEAASGLVAPNIARLQLDFADGTNVPVPVKSLGGY
FT                   RFFAYIVPSGKQSTGVTAFDAAGKALPVQTNTQYNAG"
     gtgaacgacg catatggcgg accggacacc gacggcgagg cccaagacgg cgagggactg        60
     ttcgccgacc tgggccactt cgagaccggc gccatcccgg tggacgcgac ggtgcgacag       120
     ggccgggcga tccgcacgcg gcgccgggtg atcggcagcg ggatgctggc gatcgcggcg       180
     gcgctgtcga tcggcgttcc ggtggcgatc gccggcggcg ggagttccgc cgccggcgcg       240
     gcgagcggcc cggacggcgt gtacgcagcc gtcagcagcg ggccccgtat cacggtgaac       300
     ccgacgccgc tcgtccacgg caaagggcag ttctccggcg cggtcgacgg caagaagtgg       360
     agcatcggct tcgacaacaa gaactgctac gacatcttgt gggcctgtgg ttcccagact       420
     ctggacccga gcaccaagta cggcacactc ggcgtcaacg cgaccgtcgg gaacaccgac       480
     gactacaccc tgttcacgca gcgggacgtg gcgagcgtca cggtggttct gcaggacggc       540
     gaagtcctgc acctggagac ggtcccggtc aacggcacgc ccgtggtgct cttcgcgctg       600
     ccgcccggcc tcggggtgag caagatcgtg ctcttcgacg gcaacggcgc tcagctcggc       660
     ttctcggcac cgttcacgat caaggggtcc ttcagcgctc aaggccggtg gtacaagccc       720
     ggtgagacgc cgccgccggc agcgggcccg gtcgaattgg cgcgcggcac gatgggcggc       780
     gaccagattg tcatgaccgc gtacaccggc ccgtcgggac cgtgcatcgt gtctgtgctg       840
     gggagcacct cgaacgctga ctgcatccac accggaacga tcaccgggtc ctcgatcgac       900
     aggaacggcg gagtcggaga agcggcctcg ggcctcgtcg ccccgaacat cgcccgcctg       960
     cagctcgact tcgccgacgg caccaacgtt ccggtccccg tcaagagcct gggcggctac      1020
     cgcttcttcg cctacatcgt cccgtccggg aagcaatcga ccggcgtcac cgcgttcgac      1080
     gccgccggca aagccctccc cgtccagacg aacacccagt acaacgccgg atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page