(data stored in ACNUC7421 zone)

EMBL: CP001700.PE269

CP001700.PE269       Location/Qualifiers
FT   CDS_pept        305036..306319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0271"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: sgr:SGR_3404 putative adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69224"
FT                   /db_xref="GOA:C7QJ82"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ82"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACU69224.1"
FT                   /translation="MPALVLVGAQWGDEGKGKATDLLGGSVDYVVRYQGGNNAGHTVVI
FT                   GDQKYALHLLPSGILSPGCVPVIGNGVVIDPAVLFAELDGLDQRGVDTSRLLISANAHL
FT                   ITPYHRTMDKVSERFLGKNKIGTTGRGIGPTYADKINRIGVRVQDLFDPSILLQKVEGA
FT                   LRDRNQMLVKVYNRRALSAEAVVEEYLGYAERLRPMVADTSLVVNKALDEGKVVLLEGG
FT                   QGTLLDVDHGTYPFVTSSNPTTGGACTGAGIGPTRVTRSIGILKAYATRVGAGPFPTEL
FT                   FDENGEALRRIGHEYGVTTGRDRRCGWFDAPVARYASRVNGLTDFFLTKLDVLTGFERI
FT                   PVCVAYDVDGVRHDEIPMTQTDFHHATPIYEEFPGWTEDISGCKSFEDLPENAQSYVKA
FT                   LEKMSGAPISAIGVGPERNATIQLRSFL"
     atgcccgctc tcgtgctcgt cggcgcccag tggggcgacg aaggcaaggg taaggccacg        60
     gacctgctcg gcggctcggt cgactacgtc gtccgctatc agggcggcaa caacgccggc       120
     cacacggtcg tcatcggcga ccagaagtac gcccttcacc tgctgccctc cggcatcctc       180
     tcgccgggct gcgtgccggt gatcggcaac ggcgtggtca tcgacccggc cgtgctgttc       240
     gccgagctcg acgggctcga ccagcgcggg gtggacacct cgcggctgct gatctcggcc       300
     aacgcgcacc tgatcacgcc ctaccaccgg accatggaca aggtcagcga gcggttcctg       360
     ggcaagaaca agatcgggac caccggccgg ggcatcggcc cgacctacgc ggacaagatc       420
     aaccggatcg gggtccgggt ccaggacctg ttcgacccct cgatcctgct gcagaaggtc       480
     gagggcgcgc tgcgcgaccg caaccagatg ctggtcaagg tgtacaaccg gcgcgcgctg       540
     agcgccgagg cggtggtcga ggagtacctg ggctacgccg agcggctgcg cccgatggtc       600
     gccgacacct ccctggtggt gaacaaggcg ctggacgagg gcaaggtcgt gctgctggag       660
     ggcggccagg gcacgctgct ggacgtggac cacgggacct atcccttcgt cacctcctcg       720
     aacccgacca ccgggggggc gtgcaccggc gccggcatcg gcccgacacg cgtcacccgg       780
     agcatcggca tcctgaaggc gtacgcgacc cgcgtcggcg ccggcccgtt cccgaccgag       840
     ctgttcgacg agaacggcga ggcgctgcgc cgcatcggcc acgagtacgg cgtcaccacc       900
     ggccgggacc ggcgctgcgg ctggttcgac gcgccggtcg cgcgttacgc ctcccgggtg       960
     aacggcctga ccgacttctt cctcaccaag ctcgacgtgc tgaccggctt cgagcggatc      1020
     ccggtctgcg tggcctacga cgtggacggc gtccggcacg acgagatccc gatgacccag      1080
     accgacttcc accacgcgac gccgatctac gaggagttcc cgggctggac cgaggacatc      1140
     tcgggctgca agtccttcga ggacctgccg gagaacgcgc agtcctatgt gaaggcgctg      1200
     gagaagatgt cgggcgcgcc gatctcggcg atcggcgtcg gcccggagcg caacgccacg      1260
     atccagctgc gctcgttcct gtag                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page