(data stored in ACNUC7421 zone)

EMBL: CP001700.PE27

CP001700.PE27        Location/Qualifiers
FT   CDS_pept        28115..28855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0027"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: sma:SAV_994 conventional protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68982"
FT                   /db_xref="GOA:C7QFP3"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP3"
FT                   /inference="similar to AA sequence:KEGG:SAV_994"
FT                   /protein_id="ACU68982.1"
FT                   /translation="MTRHVEFQRLHNFRDLGGYPAGAGRATKWGVLYRSDNLRKLNESD
FT                   DVERFRALDVHTVVDLRYPWEIEQSGRVPDFPGLRYVNLSIEHQPYDQGALGDDFDPWR
FT                   FLADRYMEVAQDGGKEIRGVLDVIADPESGTTVFHCASGKDRTGIIAMLVLSLIGVSED
FT                   DVVADFALTELATERLIADWKAFYPDRELTWSAYARAPKEPMELFIADLKSRYGSVEGY
FT                   AEQELGVDEALVAALKAKLVDVEG"
     atgacccgac acgtggaatt ccagcgcctg cacaacttcc gtgacctcgg cggctatccg        60
     gccggcgccg gtcgcgcgac gaagtggggc gtgctgtacc ggtcggacaa cctgcggaag       120
     ctgaacgagt ccgatgatgt cgagcgcttc cgtgcgctgg acgtccacac ggtcgtcgat       180
     ctgcggtacc cgtgggagat cgagcagtcc ggccgggttc cggacttccc gggactgcgc       240
     tacgtcaacc tgagcatcga gcaccagccg tacgaccagg gtgcgctggg agacgacttc       300
     gatccgtggc gcttccttgc ggatcgctat atggaggtcg cgcaggacgg cggtaaggag       360
     atccgcggag tcctggacgt catcgccgat ccggagtccg ggacgacggt cttccactgc       420
     gcttccggca aggaccggac cggcatcatc gccatgctgg tcctcagctt gatcggggta       480
     tctgaggacg acgtagtagc cgacttcgct ctgacggagt tggcgacgga gcggctgatc       540
     gcggactgga aggctttcta tcccgatcgc gaactcacat ggtccgcgta tgcgcgcgct       600
     cctaaggaac cgatggagct gttcatcgct gatctgaagt cccgctacgg ctctgtagag       660
     gggtacgcag aacaggaact cggcgtcgac gaggctttgg tcgccgcgtt gaaggcgaag       720
     ctagtcgacg tcgagggtta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page