(data stored in ACNUC7421 zone)

EMBL: CP001700.PE270

CP001700.PE270       Location/Qualifiers
FT   CDS_pept        306400..307788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0272"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sgr:SGR_3382
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69225"
FT                   /db_xref="GOA:C7QJ83"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ83"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACU69225.1"
FT                   /translation="MYVLVMTEISSDDLKAAGAQVFADDRAHVFHSWSAQGAITPLPIA
FT                   GAEGSYFWDYEGNRYLDFSSQLVNTNIGHQHPKVVAAIQEQAGKLCTIAPSFANDVRGE
FT                   AARLIAELAPGDLNYVFFTNGGAEAVENAVRMARLHTGRTKVLSTYRSYHGSTSTAISL
FT                   TGDPRRWANDAVGQSTGGAVHFFGPHLYRSHFHATTEAEECERALLHLEQTIQYEGPAT
FT                   VAAIILETIVGTAGVLMPPAGYLAGVRALCDKYGIVYIADEVMAGFARSGAWFAVDHWG
FT                   VTPDLITFAKGSNSGYVPVGGVIISEKIRETFKDRVYPGGLTYSGHPLACASIVATINA
FT                   MKEEGVIENAARLGEEVFGPALREIAAKHASVGEVRGVGAFWALDLVRSKETREMLVPY
FT                   NASGADAAPMNELAAAMKARGVWPFVNFNRLHVVPPCTISEADARKGLAALDEALDVVD
FT                   VYAN"
     atgtacgttc tggttatgac tgagatctcc tccgacgacc tgaaggcagc tggcgcgcag        60
     gtcttcgccg acgaccgcgc ccatgtgttc cactcctggt cggcgcaggg ggcgatcact       120
     ccgctcccga tcgccggcgc ggagggctcc tacttctggg actacgaagg caaccgctac       180
     ctggacttct cgtcccagtt ggtgaacacc aacatcggcc accagcaccc caaggtggtc       240
     gcggcgatcc aggagcaggc cggcaagctg tgcacgatcg cgccgtcgtt cgccaacgac       300
     gtccgcggcg aggccgcgcg gctgatcgcc gagctggcgc cgggcgacct gaactacgtg       360
     ttcttcacca acggcggcgc cgaggccgtc gagaacgcgg tccgcatggc gcggctgcac       420
     accggccgca ccaaggtgct gtccacctac cgcagctacc acggctccac ctcgacggcc       480
     atctccctca ccggcgaccc gcgccgctgg gccaacgacg ccgtcggcca gtccaccggc       540
     ggcgccgtgc acttcttcgg cccgcacctg taccgctcgc acttccacgc cacgaccgag       600
     gccgaggagt gcgagcgcgc gctgctgcac ctggagcaga ccatccagta cgagggcccg       660
     gcgacggtcg cggcgatcat cctggagacc atcgtgggca cggccggcgt gctgatgccg       720
     ccggcgggtt acctcgcggg cgtgcgcgcg ctgtgcgaca agtacgggat cgtctacatc       780
     gccgacgagg tgatggccgg cttcgcgcgc tccggcgcct ggttcgcggt cgaccactgg       840
     ggcgtcaccc cggacctgat caccttcgcc aagggctcca actccggcta cgtcccggtc       900
     ggcggtgtga tcatctccga gaagatccgc gagaccttca aggaccgcgt gtaccccggc       960
     ggcctgacct actccgggca cccgctggcg tgcgcgtcca tcgtcgcgac gatcaacgcg      1020
     atgaaggagg agggcgtcat cgagaacgcg gcacggctcg gcgaggaggt cttcggtccg      1080
     gcgctgcgcg agatcgccgc gaagcacgcg agcgtcggcg aggtgcgcgg cgtcggcgcg      1140
     ttctgggcgc tggacctggt ccgctccaag gagacgcgcg agatgctcgt gccctacaac      1200
     gcctccggcg cggacgcggc gccgatgaac gagctcgcgg cggcgatgaa ggcgcgcggc      1260
     gtgtggccgt tcgtcaactt caaccggttg cacgtggtgc cgccgtgcac catctcggaa      1320
     gcggacgcgc gcaagggtct ggcggcattg gacgaagcgc tggacgtcgt ggacgtgtac      1380
     gcgaactga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page