(data stored in ACNUC7421 zone)

EMBL: CP001700.PE271

CP001700.PE271       Location/Qualifiers
FT   CDS_pept        307866..309344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_5291 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69226"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69226.1"
FT                   /translation="MSHEVVFLPHILGQTWAQALAAARTAAREEDPRIVAARLEPWPDL
FT                   VLHAAQILGQIEEFRGRGQRELVHPVTRLRFTFFGEDGVIALPYWYDGPVARMAATMAF
FT                   RFAHAVESDTGLAAYDPQLRTPLSEMGLEKFVAGYLRGRERALGQAQARGPVPVGHALP
FT                   AGRSATRRELAAGPSAGRGAGFDGGGSGGPGAPGASGGAGARQGADSSRPPREVARSPR
FT                   EPKAAPRQNTDVRPGPDASRPTDPARLRPAGPVRGADAAGREAQARPRPNSDQRQPANP
FT                   VRRENKDARQAADSGPIAGSGGWLRRGKPARGEQVPRTGGVAEPRKAPRRGEPLDADPS
FT                   QRSRGPREPKAPRRGEPIDVDPSQRSRRPPEAKSPRRDESGEAQRPRRDPEPRAPRRGD
FT                   RPDAEQAQRSGKVVPPKKLSRRERAEAERAQRAQQARQAQQAKRGPVPPPETGTEWVPR
FT                   PGRPEPPEPRRAPPPERDRRQPPEPPQQQPRSRP"
     atgagccacg aggtggtgtt cctcccccac atcctgggcc agacgtgggc ccaggccctg        60
     gccgccgcgc ggaccgcggc tcgcgaggag gacccgagga tagtggccgc gcgcctggaa       120
     ccgtggcccg acctcgtgct ccacgccgcg cagatcctcg gccagatcga ggagttccgc       180
     ggacgcgggc agcgtgagtt ggtgcatccg gtgacccgtc tgcggttcac attcttcggc       240
     gaggacggcg tcatcgcgct gccgtattgg tacgacggtc cggtggcgcg catggcggcg       300
     acgatggcgt tccgcttcgc gcacgcggtg gagtccgaca ccggactggc cgcgtacgac       360
     ccgcagctgc gcacgccgtt gtccgagatg gggctggaga agttcgtcgc cggttacttg       420
     cgcggccgcg agcgggcact cgggcaggcg caggcgcgcg gtccggtgcc cgttgggcac       480
     gcgctgccgg ctgggcgcag cgcgacgcgg cgggagttgg ctgccgggcc ttcggcgggg       540
     cgtggtgcgg ggtttgatgg tggcggttct ggcggccctg gcgctcccgg cgcttctggc       600
     ggtgctggtg cgcggcaggg tgcggattcg agccgaccgc cgagggaggt cgcgcgctcg       660
     ccgcgtgagc cgaaggcggc gcctcgacag aacactgatg tacgccccgg acccgatgcg       720
     agccgcccga ccgatccggc gcggttgcgt ccggccgggc cggtgcgagg cgcggacgcc       780
     gccggcaggg aagcgcaggc gaggccgcgc ccgaactcgg accaacggca gccggcgaat       840
     ccggtgcggc gggagaacaa ggacgcgcgc caggcagccg actcgggccc gatagccggg       900
     tcggggggat ggcttcgccg agggaagccg gcgcgcggcg agcaagtacc caggaccgga       960
     ggagttgccg agccgcgcaa ggcgcctcgg cgcggcgagc ctttagacgc ggatccgtcg      1020
     cagcggtccc gaggtccgcg cgagccgaag gcgcctcggc gcggtgagcc catagacgtg      1080
     gacccgtcgc agcggtcccg gcggccgccc gaggcgaagt cgcctcggcg cgacgaatct      1140
     ggggaggcgc agcgtccccg gcgtgatccg gagcccaggg cgccccgtcg cggcgaccgc      1200
     cccgacgccg agcaggcgca acgctccggc aaggtggtgc cgccgaagaa gctgtcgcgg      1260
     cgggagcgcg cggaggccga gcgcgctcag cgggctcagc aggcgcggca ggcccagcag      1320
     gcgaagcgtg gtccggtccc gccgccggaa accggaaccg agtgggtgcc gcgcccgggc      1380
     cgtcccgaac cgccggagcc gcgccgcgca ccgccgcccg agcgagaccg ccgacagccg      1440
     ccggaaccgc cgcagcagca accgaggagt cggccgtga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page