(data stored in ACNUC7421 zone)

EMBL: CP001700.PE272

CP001700.PE272       Location/Qualifiers
FT   CDS_pept        309566..311551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1461 cell wall binding repeat 2-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69227"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69227.1"
FT                   /translation="MAPAGAASANAAPTNGPIAYTLSNPTAGFLWHTVNPDGSHDAVVP
FT                   VGDAGAYDGRGPGSGTNDWVNPAGNAVYSPDGSRVLFEGPDGCDYVADADGTGAVALTT
FT                   VPAPELGCTRLTSNSDVPELSPPIPVASARGFVWSADGRSIYYDAAGSIGRISADGRTQ
FT                   TKLAVTVPNGYKLLSVAPNGAMAFTDSSATAHIWILDPGATALRDLTTGRDAHYSPTTG
FT                   RLLVLDQVFPPSGQSALTIFAVDTVNGSRTQVTDPTIEFVQSFTWSPDGTQVAYSGESP
FT                   NGADRSSTGVFTRSLGGGPRKAVVLNPGVIWVTGWHNGPIAPARAADRIGGADRIATAV
FT                   DASQWSYMNHGAGGRQASVAVISRSDQFADALGGSALAAQKGGPLLLTATSGLDPRVRE
FT                   ELKRVLAPGSVVYVLGGDAALSPAVEQQIKALGFTTRRLAGTDRFATSVLTAQQVSAHP
FT                   HTVMVATGVQYPDALTAGAAAAQDPNGGVVVLSDDKTLPASVKSYLSGVNPAATKVYGV
FT                   GGQGVAALKGSFPQWTGKVTPLSGADRYATAAAVASSPLFAANGPVGRIGLATGGGWAD
FT                   ALSGGALIATQHGPLLLTNPGSEYLPPSELSLVKALAPHLSGAVAFGGPQALGSVATNT
FT                   FVSALGGANHFFTYSNRQSPELGGAR"
     gtggcgccgg ccggcgcggc gtctgccaac gcggcgccga ccaacgggcc gatcgcttat        60
     acgctgtcga acccgacggc gggcttcctg tggcacaccg tgaaccccga cggctcgcac       120
     gacgctgtgg tcccggtcgg cgacgccggt gcgtacgacg gccgaggacc gggatcgggg       180
     accaacgact gggtcaaccc cgcgggcaac gcggtgtact cgccagacgg ttcgcgggtg       240
     ctgttcgagg gtcccgacgg ctgcgactac gtggcggacg ctgacggcac cggcgctgtc       300
     gccctcacga ccgtccccgc tcccgaactg ggctgcacca ggctgacctc gaactccgat       360
     gtgccggagc tttcgccgcc gataccggtc gccagcgcgc gaggctttgt ctggtcggct       420
     gacggcagga gcatctacta cgacgccgcg ggctcgatcg gcaggatctc cgcggacggc       480
     aggacgcaga ccaagctcgc ggtcaccgtg ccgaacggct acaagctgct gtcggtggcg       540
     cccaacgggg caatggcgtt caccgactcg tcggccacgg cccacatatg gatcctcgac       600
     cccggtgcca ctgcccttcg cgacctcacg acaggtcgcg acgcccacta ctcgccgacg       660
     acgggccggc ttctcgtgct cgaccaggtt ttccccccca gcggccagtc cgcgctcacg       720
     atcttcgcag tggacaccgt gaacgggtcc cgtacccagg tcacggatcc gaccatcgag       780
     ttcgtccagt cgttcacctg gtcgccggac ggtacccagg tcgcgtattc gggcgagagc       840
     cccaacgggg cggaccggag ctccacaggc gtcttcactc gcagccttgg cggtggtccg       900
     cgtaaggctg tcgttctgaa ccccggcgtc atttgggtca ccggctggca caacggcccg       960
     atcgcacccg cgcgcgccgc ggaccgcatc ggcggcgcgg accgcatcgc gaccgccgtg      1020
     gacgcttcgc agtggtcgta catgaaccac ggtgccggag gccgccaggc ttcggtcgcc      1080
     gtgatcagcc gctccgacca gttcgcggac gccctcggcg gcagcgcgct ggcggcccag      1140
     aagggcgggc cgctgctgct gaccgcgacg tccggactgg acccgcgcgt gcgcgaggag      1200
     ctgaagcggg tgctggcgcc gggttcggtc gtctacgtcc tcggcggcga cgcggcgctg      1260
     agcccggcgg tcgagcagca gatcaaggcg ctgggcttca ccacgcggcg gctggccggc      1320
     accgaccgct tcgcgacctc cgtgctgacc gcgcagcagg tctcggcgca cccgcacacc      1380
     gtcatggtgg cgaccggggt gcagtacccc gacgcgctca ccgccggcgc ggctgccgcg      1440
     caggacccga acggcggcgt ggtcgtgctg tccgatgaca agacgctgcc ggcctcggtc      1500
     aagtcctacc tgtcgggcgt gaaccccgct gccaccaagg tgtacggagt cggcggacag      1560
     ggcgtcgccg cgctgaaggg ttcctttccg caatggaccg gcaaggtcac gccgctcagc      1620
     ggcgcggacc gctacgccac cgcggccgcg gtcgcctcga gcccgctgtt cgccgcgaac      1680
     ggccctgtcg gccgcatcgg cctggcgacc ggcggcggct gggcggacgc actgtcgggc      1740
     ggcgcgctca tcgccaccca gcatggtccc ctgctcctga cgaacccggg gtcggagtat      1800
     ctgccgcctt cggaactctc gctggtgaag gcgctggctc cgcatctgtc aggcgccgtg      1860
     gccttcggtg gaccgcaggc gctcggcagc gtggcgacga acaccttcgt cagcgctctg      1920
     ggcggcgcca accacttctt cacctattcg aaccgccaga gtcccgaact gggcggagcg      1980
     cgctag                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page