(data stored in ACNUC7421 zone)

EMBL: CP001700.PE273

CP001700.PE273       Location/Qualifiers
FT   CDS_pept        311616..312146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_5729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69228"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ86"
FT                   /inference="similar to AA sequence:KEGG:SAV_5729"
FT                   /protein_id="ACU69228.1"
FT                   /translation="MADYQPGLVEQARQGLGFSITEMREVNAWWQRYLRARSAPRGPER
FT                   FRAVLGPADSEQDLRTGDLVSRLYHWTLPVWPELRFEIVVGPGGQVWQEWLVRAPGAEP
FT                   PVAPADQTLEPWQYVVGDLERMYPQVRHLPEDAPTRWQSEYGYDDGHGGVVRRRARFCY
FT                   GLLQEVSEPLEVP"
     atggctgatt accagccggg tctggtggag caggctcggc agggcttggg gttctccatc        60
     accgagatgc gcgaagtgaa cgcgtggtgg caacgctatc tgcgcgcgcg ctccgcgccc       120
     cgtgggccgg aacgctttag agcggtactc gggccggcgg acagcgagca ggatctgcgg       180
     accggcgacc tggtcagccg gctgtaccac tggacgctgc cggtgtggcc ggagctgcgt       240
     ttcgagatcg tggtcggtcc cggtgggcag gtctggcagg agtggctggt gcgggcgcct       300
     ggggcggagc cgcctgttgc tccggcggat caaacgctag agccgtggca atacgtggtc       360
     ggggatctgg agcgcatgta tccacaggtg cgccatttac ctgaggacgc gcctacgcgc       420
     tggcagagtg agtacgggta cgacgacggg catggcggtg tcgtgcggcg gcgtgctcgg       480
     ttctgctacg ggcttctcca agaagtatcg gagcctctag aggttcccta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page