(data stored in ACNUC7421 zone)

EMBL: CP001700.PE274

CP001700.PE274       Location/Qualifiers
FT   CDS_pept        complement(312132..312746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0276"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: sco:SCO0748
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69229"
FT                   /db_xref="GOA:C7QJ87"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ87"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACU69229.1"
FT                   /translation="MALTTLDPKTALVLIDLQHGIVAPPAVPRSGAEVVACSKELADAF
FT                   RAQGLPVVLVNVAFSPDFGDAPKGRDDEEPEVDESEAEKDEEDMPADFAVIVDELGAQD
FT                   TDIRVTKHQWGAFHGTDLDTQLRRRGVTQIVLAGLVTSRGVDTTAREAYAHNYSVAFAI
FT                   DAMADRGIEVHENAIERIFPQIGQRATTKEILAMVQRLGNL"
     atggcgctga cgacgctgga cccgaagacc gccctcgtgc tgatcgacct ccagcacggc        60
     atcgtcgccc ctccggcggt cccccgcagc ggcgcggagg tggtggcgtg cagcaaggag       120
     ttggccgacg ccttccgtgc ccagggactt ccggtggtcc tggtgaacgt cgcgttctcc       180
     cccgacttcg gcgacgcccc gaagggacgg gacgacgaag agccggaggt cgacgagagt       240
     gaagcagaga aggatgagga ggacatgccc gccgacttcg ccgtcatcgt cgacgaactc       300
     ggcgcgcagg acaccgacat ccgcgtcacc aagcaccagt ggggcgcctt ccacggcacc       360
     gacctggaca cccagctccg ccgccgcggc gtcacgcaga tcgtcctggc cggcctcgtc       420
     accagccgcg gcgtcgacac caccgcgcgg gaggcgtacg cgcacaacta cagcgtcgcc       480
     ttcgccatcg acgcgatggc cgaccggggc atcgaggtcc acgagaacgc gatcgagcgg       540
     atcttcccgc agatcggtca gcgggccacc acgaaggaga tcctggcgat ggttcaacgc       600
     ctagggaacc tctag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page