(data stored in ACNUC7421 zone)

EMBL: CP001700.PE275

CP001700.PE275       Location/Qualifiers
FT   CDS_pept        complement(312760..314544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0277"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mbn:Mboo_0388 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69230"
FT                   /db_xref="GOA:C7QJ88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ88"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69230.1"
FT                   /translation="MTAPAPIRGTNHPRVENKEPSTAEGRPTGRIPLARSSDTPETRHD
FT                   TPTGSGSDTPGSGSSTPAGSRSDTPGPDTSTLAASRNDTPGSGNSTLPGSRGDTPSSDT
FT                   STLAASRGDTPDSDNSTLAASRSDTPDSANNTPATSRSATPAFNHRLTVPLLLGATLNP
FT                   INSSMIAIALVPIGAAFGASPAATAWLVSALYLATAIGQPVIGRLVDRFGARPLFLTGA
FT                   ALVGVAGVIGAVAPSLGVLIMARVLLGFGTSAQFPAAMHTVRGEAQRTGLKTPSGILTA
FT                   LSISAQSTMVIGPTLGGALIGVGGWRLVFAVNIPLALVCIALGARRLPKSAPVQNESRI
FT                   DLVGMGLFAAMLTSLLVFLMDLSVGNLYLLVIAAAMAGAFVRIELRSGEPFIDMRVFGG
FT                   NTPLLITYLRQTLTYVLTYSFIYGFTQWLEEGRGLSASAAGLVVLPTSLTAIVVAWFTG
FT                   RRNGIRSKLFAGTLSMIAASAALLALNRESAIWILIGVGLLAGATQGMNGLANQNALFR
FT                   QADAARMGTASGLLRTFQYLGAILSSAAVAIVFRTGASTVGLHELAVVMIACGALLLAV
FT                   VLADRSLSLRTENRGQSR"
     atgacagccc ccgcccctat ccgggggact aaccaccctc gagtcgagaa taaggaaccg        60
     tcaaccgccg aaggaaggcc caccggccgc attccactcg cacggagcag cgacacgccg       120
     gaaacgcgcc acgacacgcc gacgggctcc ggaagcgaca cgccgggctc gggcagcagc       180
     acaccagcgg gttcccgcag cgacacgccg ggcccggaca ccagcacgct cgcggcctcc       240
     cgcaacgaca ccccgggctc gggcaacagc acgctgccag gctcccgcgg cgacacgccg       300
     agctcggaca ccagcacgct cgcagcctcc cgcggcgaca ccccggactc ggacaacagc       360
     acgctcgcgg cctcccgcag cgacaccccg gactcggcca acaacacgcc ggcgacctcc       420
     cgcagcgcca ccccagcctt caaccatcgc ctcaccgtcc cgcttctgct cggggcgacg       480
     ctgaatccga tcaactcctc gatgatcgcg atcgcgttgg tgccgatcgg ggcggcgttc       540
     ggtgcctcgc ctgcggcgac tgcgtggctg gtctccgcgc tctatctggc gacggctatt       600
     gggcagccgg tgatcgggcg gcttgtggac cggtttgggg cgcgtccgct gttcctcacc       660
     ggagcggctt tggtgggcgt ggcgggggtg atcggggcgg tggcgccgtc gctcggggtg       720
     ctgattatgg cgcgcgtgtt gttggggttc gggacgagcg cgcagttccc tgcggctatg       780
     cacactgtgc ggggcgaggc gcagcgcaca gggctgaaga cgcctagcgg aatccttact       840
     gcgctctcca tatctgcgca gagcacgatg gtcatcgggc cgacgcttgg tggcgcgctc       900
     attggggtcg gcgggtggcg cctggtgttc gccgtcaaca tccccttggc gttggtctgt       960
     atagcgctcg gtgcgcgcag actccctaag agcgcgcctg tacagaacga gagccgcatc      1020
     gatctggtcg gcatggggct cttcgcggcg atgctgacca gcctgctggt gttcctcatg      1080
     gacctcagcg tcggcaatct gtatctgctg gtgatcgccg ctgcgatggc tggagcgttc      1140
     gtccgtatag agcttcgctc tggggagccc tttatagaca tgcgtgtctt cggcgggaac      1200
     accccgctgc tgatcaccta tctacggcag acgctcacgt acgttctcac ctactccttc      1260
     atctacggat tcacgcagtg gctggaggag ggacgcggac tcagcgcgtc cgcagctggg      1320
     ctcgtcgtcc tgccgacgtc gctcaccgcg atcgttgtcg cctggttcac ggggcggcgc      1380
     aatggcatcc gcagcaagct cttcgcgggg accctgtcga tgatcgcggc gtccgcggca      1440
     ttgctggcgc ttaaccggga gagcgctata tggatcctca taggcgtggg tctcctagcg      1500
     ggtgcgacgc aggggatgaa cggcctcgcc aaccagaacg ccttgttccg tcaggcagat      1560
     gcggcgcgta tgggaaccgc gtcagggctt ctgcggacct tccagtacct gggcgcgatc      1620
     ctgtcctcag ctgccgtggc gatcgtcttc cgtaccgggg cttccacggt cggccttcac      1680
     gagctggccg tcgttatgat cgcttgcggc gcgctgctgc tcgccgtggt cctcgccgac      1740
     cgctcgctgt ccctccgcac cgagaaccgc ggacagagcc gataa                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page