(data stored in ACNUC7421 zone)

EMBL: CP001700.PE276

CP001700.PE276       Location/Qualifiers
FT   CDS_pept        complement(314541..315068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0278"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bmj:BMULJ_04209 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69231"
FT                   /db_xref="GOA:C7QJ89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ89"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69231.1"
FT                   /translation="MDVQPGTIALGGEDAVDGADAAHAADAVRPAGAAHPADAAHAARE
FT                   LRVLVGRLRRRLREVDDVHELTASQLAVLGRLDRDGPASTSDLAKAEHVRPQSMAATIA
FT                   VLEERGMIARRQDPDDGRRQLIELTPTADETVRGSRRARDEWLERALRERFSPEELATV
FT                   VTALGMLERLSE"
     atggatgttc agcctggaac gatcgccttg ggcggcgagg acgctgttga cggcgcggac        60
     gcggcgcacg ctgccgacgc cgtgcgccct gccggcgcgg cgcaccccgc cgacgccgcg       120
     cacgccgccc gcgagctgcg cgtgctggtc ggccgcctgc gccgccggct ccgcgaggtc       180
     gacgacgtcc acgaactgac cgcctcgcag ctggccgtcc tgggccgcct ggaccgcgac       240
     ggcccagcct cgaccagcga cctggcgaag gccgagcacg tccgaccgca atcgatggcc       300
     gcgaccatcg cggtcctgga ggaacgcggc atgatcgccc gccgccaaga cccggacgac       360
     ggccgccgcc agctgatcga gctgaccccg accgccgacg agacagtccg gggctcccgt       420
     cgcgcacgcg acgaatggct ggaacgagcc ctccgggaac gcttctcgcc ggaggaactc       480
     gcgacggtgg tcacggcgct cggcatgctc gaacggctca gcgaatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page