(data stored in ACNUC7421 zone)

EMBL: CP001700.PE277

CP001700.PE277       Location/Qualifiers
FT   CDS_pept        315130..316383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0279"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: sma:SAV_4149 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69232"
FT                   /db_xref="GOA:C7QJ90"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ90"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACU69232.1"
FT                   /translation="MKVLVIGTGGREHALARALSTDPAVTALYCAPGNPGIAEVAELRA
FT                   VDPLDPAAVRDLAVELGADLVVVGPEAPLVAGVADPVREAGIPVFGPSKAAALLEGSKA
FT                   FSKEVMAAAGIPTAKSYVCETDAEYAKALDEFAGFPYVVKDDALAAGKGVVVTEDRAAA
FT                   LEHARACGRVVIEEYLDGPEVSLFGITDGTAVVPMMPSQDFKRIGDGDTGLNTGGMGSY
FT                   CPLPWTPEGLTDEVVATVIQPLVDEMRRRGTPFVGLVYAGLALTAKGLRVVEFNARFGD
FT                   PETQSVLAMLESPLSELLYPAATGTLADAPAPRWRDGASVTVVLAATGYPGTPRSDDVI
FT                   TGIDAAEQLGTVVNQAGTKQNAEGAVVTSGGRVLAVTAVADSLGAARGKAYEGVAAITF
FT                   DGAQHRTDIAAEAAKTAA"
     atgaaggtcc tcgtcatcgg caccggcggc cgcgagcacg ccctcgcccg cgccctcagc        60
     accgaccccg ccgtcaccgc gctctactgc gcgcccggca accccggcat cgcggaggtc       120
     gccgagctgc gcgcggtcga ccccctggac ccggccgcgg tgcgggatct ggccgtggaa       180
     ctcggcgcgg acctggtcgt ggtgggtccg gaggcgccgc tggtcgcagg tgtcgcggac       240
     ccggtgcgcg aggcggggat cccggtgttc gggccgtcga aggccgccgc gctcctggag       300
     gggtcgaagg ccttctccaa ggaggtcatg gccgccgccg ggattccgac cgcgaagtcc       360
     tacgtctgcg agaccgatgc cgaatacgcc aaggcgctcg acgagttcgc cggcttcccc       420
     tatgtggtga aggacgacgc gctcgccgcc ggcaagggcg tcgtcgtcac cgaggatcgc       480
     gccgccgccc tggagcacgc gcgcgcatgc ggccgcgtgg tgatcgagga gtacctcgac       540
     ggcccggagg tctccctgtt cggcatcacc gacggcaccg cagtcgtccc gatgatgccc       600
     tcgcaggact tcaagcggat cggcgacggc gacaccggcc tcaacaccgg cggcatgggc       660
     tcgtactgcc cgctgccgtg gacaccggag ggtctgaccg acgaggtcgt cgcgaccgtg       720
     atccagccgc tcgtcgatga gatgcggcgg cgcggcaccc cctttgtcgg gctcgtctac       780
     gccggtctgg cgctgaccgc caagggtctg cgcgtcgtgg agttcaacgc gcgcttcggg       840
     gaccccgaga cgcagagcgt cttggcgatg ctggaatcgc cgctgtccga gctgctctac       900
     ccggccgcga ccggcacgct cgccgacgcc cctgcgccgc gttggcgtga cggcgcctcc       960
     gtcaccgtgg tgctggccgc cacgggttac ccgggcacgc cgcgcagcga tgacgtcatc      1020
     accgggatcg acgccgccga gcagctgggc accgtggtga accaggccgg gaccaagcag      1080
     aacgcggagg gcgccgtggt cacctccggc ggtcgggtgc tggcggtgac cgctgtggcg      1140
     gacagtctcg gcgccgcgcg cggcaaggcg tacgagggcg tcgcggccat cactttcgac      1200
     ggcgcgcagc accgcaccga catcgcggca gaggctgcca agacagccgc ctga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page