(data stored in ACNUC7421 zone)

EMBL: CP001700.PE278

CP001700.PE278       Location/Qualifiers
FT   CDS_pept        316528..317934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69233"
FT                   /db_xref="GOA:C7QJ91"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ91"
FT                   /inference="similar to AA sequence:KEGG:SGR_3860"
FT                   /protein_id="ACU69233.1"
FT                   /translation="MTATTARVSAHRAARALLRVRAWVIAAYALSAAAACAALIGLARV
FT                   RGWDGVGAGAVGAAAVVCVLWALPAIRLHRGALAPPKTVQLAGESAPELELLVRQLALQ
FT                   LQVPTPAGIELSPDCDAWLDPRPGGPVLVIGAPFLWWLRVSELRGLLAPLVAGMAAAGD
FT                   ERIVRARAFANRSIGALHGRPGRTPHVFPSLRRRLAGYFEARAEVLERVVAWEAVAASR
FT                   MIEPAARAYAHEQINMAAAGWDRVLTRLAQPAWESGYCPVGLNVALVGALTSLGRRDRM
FT                   AGSLATRLSERPACDLLEEPGDVDARASRMAAELFEGRRIERTVTWERYVTAVTEPELV
FT                   RRAESVPDEHPVAKRIRTLISEAGVPGARQGGVSDGGTRSAVIPAPRVGEADGVPSGDV
FT                   MEPDIDDFAAYLAVRLVEARLAAWGLDWLDGPVLRDRAGDPVPIHDMAASVADVGDVSR
FT                   LSDWLARNLP"
     gtgactgcga cgacggcgcg ggtgagcgct cacagggcgg cccgcgcgct actgcgcgtc        60
     cgcgcgtggg tgatagcggc gtacgccctg agcgctgccg cggcatgcgc ggctctgatc       120
     ggactggcgc gcgtgcgcgg ctgggacggt gtcggagccg gtgcggtcgg ggcggctgcg       180
     gtggtgtgcg tgctgtgggc actgcccgcg atccggctgc atagaggcgc tttggcgccg       240
     ccgaagactg tgcaactggc cggtgagtcg gcgcccgaac tcgaactgtt ggtgcggcag       300
     ttggcgctgc aactccaagt gccgactcct gccggcatcg agctgtctcc cgactgtgat       360
     gcctggctgg atcctcgtcc cggcggtccg gtgctcgtca tcggggcgcc tttcctgtgg       420
     tggctgcgcg tcagcgagtt gcgcgggttg ctggcgccgt tggtcgccgg gatggcggcg       480
     gccggggacg aacggatcgt gcgggcgcgg gcgttcgcca accggagtat cggtgcgctt       540
     catggtcgtc cggggcggac gccgcatgtg tttccttcgt tgcgccgacg gctggcgggg       600
     tacttcgaag ctcgcgcgga ggtactggag cgggttgtcg cgtgggaggc agtggcagcc       660
     tcgcggatga tcgagcccgc cgcgcgcgct tatgcacatg agcagatcaa catggcggcc       720
     gccgggtggg accgcgtgct cactcgtttg gcgcagccgg cgtgggagtc ggggtactgc       780
     ccggtcgggc tgaacgtggc gctggtcggg gcgctgacct cgttggggcg ccgggaccgg       840
     atggccggtt cgctggcgac gcggctgagc gagcggccgg cgtgcgacct gctggaggag       900
     cccggggacg tggacgcgcg cgcgtcgcgg atggccgcgg agctgttcga ggggcggcgg       960
     atcgagcgga cggtgacgtg ggagcggtac gtcacggcgg tcacggagcc ggagctggtg      1020
     cggcgcgcgg agtcggtgcc ggacgagcat cctgtggcga agcggatacg caccctgatc      1080
     agcgaggcgg gggtgccggg ggcgcggcag ggcggggtgt ccgatggtgg gacgcggagt      1140
     gcggtgatcc cggctccgcg cgtgggggaa gccgacgggg ttccgtcggg cgatgtcatg      1200
     gagccggaca tcgacgactt cgcggcgtat ctggcggtgc ggctcgtcga ggcgcggctg      1260
     gcggcgtggg gactggactg gctggacggg ccggtgctgc gcgaccgcgc cggcgacccg      1320
     gtgccgatcc acgacatggc ggcgtcggtc gcagacgtcg gtgatgtttc ccgattgtct      1380
     gattggctgg ctagaaacct cccctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page