(data stored in ACNUC7421 zone)

EMBL: CP001700.PE279

CP001700.PE279       Location/Qualifiers
FT   CDS_pept        318027..318638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0281"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_1454 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69234"
FT                   /db_xref="GOA:C7QJ92"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ92"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69234.1"
FT                   /translation="MRVTRESDQHGSEQYGTDETGSITGGSGDEEFGRLVVARSHALRR
FT                   TAYLMCGDWFEAEDLVQQALIKLHAAWGRVQRHDDLDAYLRKTLLRTCIDEKRRARWSK
FT                   EHPASDAMPDTVEAPGEPDPETLSDRDELVAALRELPSGQRAVLILRFWEDLSVEETAQ
FT                   LLKCTAGTVKSQTSRGLGALREAFGVDRAGALLARTEGKA"
     atgcgcgtta cgcgggaatc cgatcagcac ggttccgagc agtacgggac tgatgaaacc        60
     gggtccatca ccggcggctc cggcgacgag gagttcggcc ggctggtcgt cgcgcgctcg       120
     cacgccctcc gccggacggc gtatctgatg tgcggcgact ggttcgaggc cgaggatctg       180
     gtccaacagg cgctcatcaa gctgcacgcc gcctgggggc gggtgcagcg ccacgacgac       240
     ctggacgcgt atctgcgcaa gaccctgctg cggacctgta tcgacgagaa acgcagggcc       300
     cggtggagca aggagcatcc ggcctcggac gcgatgccgg acaccgtcga ggcgccgggc       360
     gagcccgatc ccgagacgct gtccgatcgc gacgagctgg tcgccgccct gcgcgagctg       420
     ccgagcggcc aacgggccgt gctgatactg aggttctggg aggacctcag cgtcgaggag       480
     acggcgcagt tgctcaagtg cacggcgggc actgtgaaga gccagacctc gcgtgggctg       540
     ggcgcgctgc gggaggcgtt cggggtggac cgcgccggtg ccctgttggc gaggacggaa       600
     gggaaggcat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page