(data stored in ACNUC7421 zone)

EMBL: CP001700.PE28

CP001700.PE28        Location/Qualifiers
FT   CDS_pept        complement(28835..29308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0028"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rle:RL2084 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68983"
FT                   /db_xref="GOA:C7QFP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU68983.1"
FT                   /translation="MTDIEIRPATLDDLDGLSHDSAELFAEDGLARDRLRDPDWPRDNN
FT                   RAWCAGLIAAPDALVLVATEEGTVVGHLIGTFSPASSMWTAARAELVSTHVAPSYRGQG
FT                   IGGRMVEDFIAWGKDRGAARLHVSAYTANSAAIRFYQRFGFVPLSIELTLDVD"
     atgaccgaca tcgagatccg cccggcgact ctggacgatc tggacggcct cagccacgac        60
     agcgccgaac tgttcgcgga ggacggcctc gcgcgggatc gcctgcgcga cccggactgg       120
     ccgcgcgaca acaaccgcgc gtggtgcgct ggactgatcg ccgcccctga tgccctggta       180
     ctggtcgcca cagaggaagg cactgtagtc gggcacctga taggcacttt tagcccggcg       240
     tcctctatgt ggaccgcagc gcgcgccgaa ctggtcagta cgcatgtagc gccctcctat       300
     agaggacaag ggatcggcgg acgcatggtc gaggacttca tcgcctgggg aaaggaccgc       360
     ggcgcggcgc gcctccacgt ctccgcgtat acggcgaaca gcgccgcgat ccgcttctat       420
     cagcgcttcg gcttcgtacc gctgtcgatc gagctaaccc tcgacgtcga ctag             474
//

If you have problems or comments...

PBIL Back to PBIL home page