(data stored in ACNUC7421 zone)

EMBL: CP001700.PE280

CP001700.PE280       Location/Qualifiers
FT   CDS_pept        318635..320263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD3349 putative exosporium glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69235"
FT                   /db_xref="GOA:C7QJ93"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69235.1"
FT                   /translation="MTLMDEGAGDCETTMGNDINDISETNETGTTSATASTAATSLTAN
FT                   DPQDTDASSVELAWAHDLFDNTRGEAEPPWAVDLAVITKAGHRRRRFRRARTGGGVLAV
FT                   LAVTTAAAVTLGAGTTDYGSSAGPAGGWGARPLQDVFRYVEVNGGSFPGNNGDLYHHVP
FT                   KSAAVDAAVLVGHLDPAGTHLRGEPDRPDGPNPRIVGDGDAWVKGAANIEMSSDWSADG
FT                   TGPTSAQVSYGFFDDVNTLRTGIAGRPVSGPCGLNMELFLGVIDPTGTTPLPQWSGCRY
FT                   TTLADGSRVAAASASVGAGTETVAVRIFGSGNVIGMLGTNYQWTAAVDGARPSARAVVT
FT                   PSPWSEDGFRAALSDTALVPVLHPRGPVNADGKLLVPSDIGSDWAYDPTGGSEGTGEFV
FT                   LDNGCTPDHSIFGLASGRAVGYTGTLPDGTAGTGFEGEYRLPAGTGARTMQDAQKYGQG
FT                   GCGGFSQDTVAALPSGIGDSAFLLYQPQQSTVRVTVRLGDTILQTDIGRADHSPLTLTS
FT                   AADRTWLQQIAQRMVAHYTGVAGRG"
     atgaccctga tggatgaggg cgccggggac tgtgagacga ccatgggcaa cgacatcaac        60
     gacatcagcg agaccaacga gaccggtacc accagtgcga ccgcttcgac ggccgccact       120
     tctctgacgg cgaacgaccc gcaggacacc gatgccagct cggtcgagct ggcctgggcc       180
     catgatctct tcgacaacac gcgcggcgag gccgaaccgc cgtgggccgt ggacctcgcg       240
     gtcatcacga aggccggaca ccggcggcgg cggttccgcc gggcccggac cggcggcggg       300
     gtgctggcgg tgctcgcggt caccaccgcg gcggcggtga cgctcggcgc cgggaccacg       360
     gactacggca gcagcgcggg tccggccggc ggctggggcg cgcggccgct gcaggacgtc       420
     ttccggtacg tggaggtcaa cggcggttcg tttccgggga acaacggaga cctctaccat       480
     cacgtgccga agtcggcggc ggtcgacgcg gcggtgctgg tcgggcacct ggatccggcc       540
     ggcacgcatc tgcgggggga accggacagg ccggacggcc cgaacccgcg gatcgtcggt       600
     gacggcgatg cctgggtgaa gggcgcggcg aatatcgaga tgagctcgga ttggtcggcc       660
     gacgggaccg gtccgacgag cgcgcaggtc tcctacgggt tcttcgacga tgtgaacacc       720
     ctccggaccg gcatcgcggg gaggccggtg tccgggccgt gcggtctgaa catggagctg       780
     ttcctcggcg tgatcgatcc gaccggcacc acgccgttgc cgcagtggtc cgggtgccgg       840
     tacaccacgc tggcggacgg atcccgggtc gccgccgcgt ccgcctcggt cggcgcgggg       900
     acggagacgg tcgccgtgcg gatattcggc tccgggaacg tgatcggcat gctgggtacc       960
     aactatcagt ggacggcggc ggtcgacggc gcgcggccct ccgcccgcgc ggtcgtgacc      1020
     ccgtcgccct ggtcggagga cgggttccgg gccgcgctgt ccgataccgc actggttccc      1080
     gtgctccacc cgcggggtcc ggtgaacgcg gacggcaagc tgctggtgcc ctccgacatc      1140
     gggtcggatt gggcgtacga ccccaccggc ggctcggagg gcaccgggga gttcgtcctg      1200
     gacaacggct gcaccccgga ccacagcatc ttcggcctgg cgtccggccg cgccgtgggc      1260
     tacaccggga ccctgccgga cgggaccgcg ggcaccgggt tcgaaggcga ataccggctg      1320
     cccgccggga ccggcgcacg gacgatgcag gatgcgcaga agtacggtca gggcggctgc      1380
     ggcggcttct cccaggacac ggtggcggcg ttgccctcgg ggatcggcga cagcgccttc      1440
     ctgctatacc aaccgcagca gagcaccgtg cgggtgacgg tccggctcgg cgacacgatc      1500
     ctgcagaccg acatcggccg tgccgaccat tcgccgctga ccctcacctc ggcggccgac      1560
     cgcacctggc tccaacagat cgcgcagcgg atggtcgcgc actacaccgg ggtggcggga      1620
     cggggttga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page