(data stored in ACNUC7421 zone)

EMBL: CP001700.PE281

CP001700.PE281       Location/Qualifiers
FT   CDS_pept        320386..321696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0283"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: tfu:Tfu_3014 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69236"
FT                   /db_xref="GOA:C7QJ94"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ94"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ACU69236.1"
FT                   /translation="MIERYTLPEMGRVWSEAHKYELWARVETLVVEAHAAAGTIPESAV
FT                   EPVRKAAPPTPEAVAAIEAVTQHDVIAFLSAWADNTEPREAATYVHFGMTSSDLLDTAL
FT                   ALQLTEATDLLLEKADKLVGVLRDHALAHRATLRVGRTHGIHGEPDVWGHRVADFAFGV
FT                   ARSRDRLRRAREAVGVVAISGAVGTYSNIDPAIETFVAAKLGMTAADVSTQVILRDGVS
FT                   EWVSALAIMATVLEAIALEVRHGQRTEVRELWEPFGKGQKGSSAMPHKKNPIISERLAG
FT                   LARIVRAQVVPVMEGIPLWHERDISHSSTERIALPDASIAVDYMLNLTIRLMSGLVVDP
FT                   DRMRHNLDSTGGLVYSSTVLLELVEMGLERDTQAYPLTQRASMKTWETGRPFRETLREE
FT                   AATAGLAIDEARLDEATRPERFVQRLDGMFEKLAKLS"
     atgatcgagc gttacaccct gcccgagatg ggccgtgtct ggtccgaagc ccacaagtac        60
     gaattgtggg cgcgggtcga gacgctggtc gtggaggcgc acgcggcggc cggcacgatt       120
     ccggagtcgg ccgtggagcc ggtgcgcaag gccgcgccgc cgaccccgga ggcggtcgcg       180
     gcgatcgagg cggtgacgca gcacgacgtg atcgcgttcc tgtcggcgtg ggcggacaac       240
     accgagccgc gcgaggccgc cacctatgtg cacttcggga tgacgtcctc ggatctgctg       300
     gacacggcgc tcgcgctgca gctcaccgag gccaccgacc tgctgctgga gaaggcggac       360
     aagctggtcg gcgtgctgcg ggaccacgcg ctggcgcacc gtgcgacgct gcgcgtcggc       420
     cgtacccacg gcatccacgg cgagccggac gtctgggggc accgggtcgc cgacttcgcg       480
     ttcggcgtgg cgcgctcccg cgaccgcctg cgccgggccc gcgaggcggt cggcgtcgtg       540
     gcgatctccg gcgcggtcgg cacgtactcc aacatcgacc cggcgatcga gaccttcgtc       600
     gccgccaagc tcgggatgac cgcggccgac gtctcgaccc aggtgatcct gcgcgacggc       660
     gtctccgagt gggtgtccgc cctggcgatc atggccaccg tgctggaggc gatcgctctg       720
     gaggtccgcc acggccagcg caccgaggtc cgcgaactgt gggagccgtt cggcaagggc       780
     cagaagggct cctcggccat gccccacaag aagaacccga tcatctccga gcgcctggcc       840
     ggcctggccc gcatcgtccg cgcccaggtc gtgccggtga tggagggcat cccgctgtgg       900
     cacgagcgcg acatctcgca ctcctccacc gagcgcatcg ccctccccga cgcctccatc       960
     gccgtggact acatgctgaa cctgaccatc cgcctgatga gcggcctggt cgtcgacccc      1020
     gaccgcatgc ggcacaacct cgactccacc ggcggcttgg tctacagctc caccgtcctg      1080
     ctcgaactcg tcgaaatggg cctcgaacgc gacacccagg cctaccccct gacccagcgc      1140
     gcctccatga agacctggga aaccggccgc cccttccgcg aaaccctccg cgaagaagcc      1200
     gccaccgccg gcctcgccat cgacgaagcc cgcctcgacg aggcgacccg ccccgagcgc      1260
     ttcgtccagc gcctggacgg catgttcgag aagctggcca agctgagctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page