(data stored in ACNUC7421 zone)

EMBL: CP001700.PE282

CP001700.PE282       Location/Qualifiers
FT   CDS_pept        322799..322996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_3261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69237"
FT                   /db_xref="GOA:C7QJ95"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ95"
FT                   /inference="similar to AA sequence:KEGG:SACE_3261"
FT                   /protein_id="ACU69237.1"
FT                   /translation="MVRINLRLPSNLKALVEDAAGAAGLSVNAWIVRAAAAGLANEDRR
FT                   AGRAQRSDRIVGDSYSGWAR"
     atggtgcgga tcaacctgcg gttgccgtcg aatctcaagg ccctggtcga ggacgctgcc        60
     ggggcggcgg ggttgtccgt caacgcgtgg atcgtgcggg cggctgctgc cgggctggcc       120
     aatgaggatc ggcgtgccgg gcgggcgcag aggtccgatc ggatcgtggg cgacagctat       180
     agcggctggg cgcgttga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page