(data stored in ACNUC7421 zone)

EMBL: CP001700.PE283

CP001700.PE283       Location/Qualifiers
FT   CDS_pept        323059..323949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69238"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ96"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02601"
FT                   /protein_id="ACU69238.1"
FT                   /translation="MSHSTFNTPAAIAVALDLYVADVRIVAADRADTVVEVRPSDPNKA
FT                   ADVKAAENTRVEYDEGARVLSIVSRKPRNRFVNFSSKRPESIDLLIEVPTDSDVRGETE
FT                   IGDFESVGVLGAVQLKAGVGTVRLAQVGPVNIRDGVGEVLIEEVSGAADVNCGSGVIRL
FT                   GAVDGTAEVSNGNGKVRVGVVTGAANVKSANGEVSVDRALSDITASASNGEVRVGEVVR
FT                   GKATVTSKNGAVEVGVREGSAAWLELSTAVGRVYNELESADAPQAGEPVDKVEIHASTK
FT                   LGDVTIRRVPRLDED"
     atgtcacact ccaccttcaa cactcccgcc gcgatcgccg tcgctctcga cctctatgtc        60
     gcggacgttc ggatcgtggc cgccgatcgc gccgacacgg tcgtcgaggt gcggccgagc       120
     gatccgaata aggctgctga cgtcaaggcc gcggagaaca cgcgcgtcga gtatgacgag       180
     ggggctcggg tgctcagcat cgtcagtcgc aagccgcgga accggttcgt caacttcagc       240
     tcgaagcggc cggagtccat cgacctgctc atcgaggtgc cgactgactc cgatgtgcgg       300
     ggtgagaccg agatcggtga cttcgagtcc gtcggtgtgc tcggcgcggt gcagctcaag       360
     gctggtgtgg ggactgtgcg gctggctcag gtcgggccgg tgaacatccg cgacggtgtc       420
     ggtgaggttc tcattgagga ggtcagtggt gctgccgatg tgaactgcgg gtccggtgtc       480
     atccggctcg gcgccgtgga cgggaccgcc gaggtgtcca acggcaacgg caaggtgcgc       540
     gtcggggttg tgaccggggc ggcgaatgtg aagtccgcca acggtgaggt gtccgtcgat       600
     cgtgcgctgt ccgacatcac cgcctccgcc tccaacggag aggtgcgggt cggcgaggtc       660
     gtgcgcggta aggcgaccgt cacgtcgaag aacggtgccg tcgaggtcgg cgtgcgcgag       720
     ggcagcgcgg cctggctgga gctgagcacc gcggtcggcc gcgtctacaa cgagctcgaa       780
     tccgccgacg cgccgcaggc cggcgagccg gtcgacaagg tcgagatcca cgccagcacc       840
     aagctcgggg acgtcaccat ccgccgcgtg ccgcgcctgg atgaggactg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page