(data stored in ACNUC7421 zone)

EMBL: CP001700.PE284

CP001700.PE284       Location/Qualifiers
FT   CDS_pept        323955..324878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0286"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: sco:SCO4405 ABC transport system ATP-binding
FT                   protein; TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69239"
FT                   /db_xref="GOA:C7QJ97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ97"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ACU69239.1"
FT                   /translation="MIAISARGLRKSFGEKTVLDGIDLSVPAGTILALLGPNGAGKTTA
FT                   VHLLTTYLRPDAGEIVIAGHDLAKSPQAVRRVIGVTGQFSAVDGYLTGRENLMLMADLH
FT                   LLPKAVGRQRADDLLERFELTEAAGKAAATCSGGMKRKLDLAMTLVGDPKVIFLDEPTT
FT                   GLDPRSRRVMWDIIRGLVAEGTTILLTTQYLDEADQLAHRVAVLDGGRIVAEGTPAELK
FT                   TRIPGGHIELTFADRAELDAAALVLAPTHRDDDALTLQLAGDGRVSALRSLLQRLDDAS
FT                   VEVEALAVHTPDLDDVFFALTGKKGA"
     ttgatagcga tctcagcgcg tggcttgcgc aagtccttcg gcgagaagac ggtgctcgac        60
     ggcatcgatc tgagcgtgcc ggccgggacg atcctggcgc tgctcggccc gaacggcgct       120
     ggcaagacca cggcggtcca tctgctcacc acctacctgc gaccggatgc cggggagatc       180
     gtcatcgcag ggcacgatct cgcgaagagt ccccaggctg tgcggcgggt gatcggggtg       240
     accgggcagt tctccgcggt cgacgggtat ctcaccgggc gcgagaacct gatgctgatg       300
     gctgatctgc acctgttgcc gaaggctgtg gggcggcagc gggccgacga tctgctggag       360
     cgcttcgagc tgaccgaggc ggcggggaag gcggcggcga cctgttccgg ggggatgaag       420
     cgcaagctcg atctggcgat gacgctggtc ggagacccga aagtgatctt cctcgacgag       480
     ccgacgacgg ggctggaccc gcggagccgc cgcgtcatgt gggacatcat ccgcgggctg       540
     gtcgcggagg ggacgaccat cctgctgacc acgcaatacc tcgacgaggc cgaccagctc       600
     gcgcaccggg tcgcggtgct ggacggcggg cggatcgtcg ccgaggggac gccggccgag       660
     ctcaagaccc ggattccggg cgggcacatc gagttgacct tcgccgaccg cgccgagttg       720
     gacgccgccg cgctggtgct cgcgccgacc catcgcgacg acgacgcgct cacgctccaa       780
     ctcgccggcg acgggcgggt cagcgccctg cggtccctgc tccagcggct ggacgacgcc       840
     tcggtcgagg tcgaggcgct ggccgtgcac acccccgacc tcgacgacgt gttcttcgcg       900
     ctgaccggca agaagggagc ttga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page