(data stored in ACNUC7421 zone)

EMBL: CP001700.PE285

CP001700.PE285       Location/Qualifiers
FT   CDS_pept        324880..325734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0287"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rha:RHA1_ro02603
FT                   multidrug ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69240"
FT                   /db_xref="GOA:C7QJ98"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ98"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU69240.1"
FT                   /translation="MSAMTVADSGLADTGADTRSHAWVHARIMLRRNLRHLQRYPSLTL
FT                   MVTLMPLVFLLLFVYVFGGTLGSGLGSLTPAGVHGGRAAYAAYVAPAIIVMAVAAAAQG
FT                   TAIAVAQDMTEGIIARFRTMAVARSSVLTGHVVGAAIQTMAGVAVVVGAALAVGFRPHA
FT                   NAAEWFAALGVVLLLTFAVTWLCVGLGLSAKSVETASNSPMFLLLLPFLSSGFVPTDSL
FT                   PTGMRWFSEYEPFTPVTETLRGLLTGTRIGGDLVVTLAWCLGVAVLSYAWSRRLYEREP
FT                   KQS"
     atgagtgcga tgaccgtggc cgactccggt ctggccgaca ccggcgccga cacccgctcg        60
     cacgcctggg tccacgcccg gatcatgctg cgccgcaacc tgcgccacct gcagcgctac       120
     ccgtcgctga ccctcatggt caccttgatg ccgctggtct tcctgctcct gttcgtctac       180
     gtcttcggcg ggacgctcgg gtccgggctc ggcagcctca ccccggccgg cgtgcacggc       240
     ggccgtgcgg cgtacgccgc ctacgtcgcc ccggcgatca tcgtgatggc ggtggccgcg       300
     gcggcgcagg gcacggcgat cgccgtcgcc caggacatga ccgagggcat catcgcccgc       360
     ttccggacca tggccgtcgc gcggtcgtcg gtgctgaccg ggcacgtcgt cggcgccgcg       420
     atccagacca tggccggtgt cgcggtcgtg gtcggcgccg cgctcgcggt gggcttccgc       480
     ccgcacgcga acgcggccga gtggttcgcc gcgctcggcg tggtcctgct gctgaccttc       540
     gccgtcacct ggctgtgcgt cgggctcggg ctgtcggcca agagcgtcga gaccgcgagc       600
     aactcgccga tgttcctcct gctgctgccc ttcctgagca gcggtttcgt tccgaccgac       660
     tcgctgccga cggggatgcg ctggttctcc gagtacgagc ccttcacgcc ggtgaccgag       720
     accctgcgcg ggctgctgac cgggacgagg atcggcggcg acctggtcgt cacgctggcc       780
     tggtgcctcg gcgtcgcggt gttgtcctac gcctggtcgc gacggctata tgagcgcgag       840
     cccaagcaga gttga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page