(data stored in ACNUC7421 zone)

EMBL: CP001700.PE286

CP001700.PE286       Location/Qualifiers
FT   CDS_pept        325731..326642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0288"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: fra:Francci3_4373
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole- succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69241"
FT                   /db_xref="GOA:C7QJ99"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ99"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACU69241.1"
FT                   /translation="MNRRYSERVITGLNHLASGKIRDLYAVGDDLLLVASDKISAFDYV
FT                   LESEIPDKGRILTQLSMWWFRQLADLVPNHVISADVEQFPAELQPYKEELRGRSMLCRK
FT                   LSMVQVECVARGYLTGSGLAEYERTRTANGVPLPPGLVDGSRLDRPIFTPAMKAEVGQH
FT                   DENVSFEDMAERIGDPELAAQLKDLTLAVYSRAREIAEERGIILADTKFEFGRLRGGTL
FT                   VLADEVLTPDSSRFWPADEWKPGRTQSSFDKQYVRDWLSSPASGWDRKSDTPPPVLPEE
FT                   VVQATRARYVEAYERLTGAKFD"
     ttgaaccgcc ggtattctga gcgcgtgatc accggtctga accacctcgc cagcggcaag        60
     atccgcgacc tgtacgcggt cggcgacgac ctgctcctcg tcgcctccga caagatctcc       120
     gccttcgact acgtgctgga gtccgagatc ccggacaagg gccggatcct cacccagctg       180
     tccatgtggt ggttccgcca gctcgccgac ctggtgccga accatgtgat cagcgccgac       240
     gtcgagcagt tcccggcgga gttgcagccc tacaaggagg agctgcgcgg gcgctcgatg       300
     ctctgccgca agctgagcat ggtgcaggtc gagtgcgtgg cgcgcggcta cctgaccggc       360
     tccgggctgg ccgagtacga gcggacccgc accgccaacg gcgtgccgct gccgcccggg       420
     ctggtcgacg gctcgcggct ggaccgcccg atcttcaccc cggcgatgaa ggccgaggtc       480
     gggcagcacg atgagaacgt cagcttcgag gacatggccg agcggatcgg cgacccggag       540
     ctggccgcgc agctgaagga cctgacgctg gcggtctact cgcgggcccg cgagatcgcc       600
     gaggagcgcg ggatcatcct ggccgacacc aagttcgagt tcgggcggct gcgcggcggg       660
     accctggtcc tcgccgacga ggtgctgacc ccggactcct cgcgtttctg gccggcggac       720
     gaatggaagc cgggacgcac gcagtcctcg ttcgacaagc agtacgtccg cgactggctg       780
     agctccccgg cctcgggctg ggaccgcaag tccgacaccc cgccgccggt gctgccggag       840
     gaggtcgtgc aggcgacccg ggcccgctac gtcgaggcct acgagcgcct caccggagcg       900
     aagttcgact ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page