(data stored in ACNUC7421 zone)

EMBL: CP001700.PE287

CP001700.PE287       Location/Qualifiers
FT   CDS_pept        326749..327015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0289"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: sco:SCO4077 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69242"
FT                   /db_xref="GOA:C7QJA0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA0"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ACU69242.1"
FT                   /translation="MARVLVDVMLKPEILDPQGQAVQRALPRMGFDSVTNVRQGKRFEL
FT                   ELADADPATLRATAEQMAEKLLANTVIEDFKVTVLPADSSENA"
     gtggcccgcg tcctcgtcga cgtcatgctc aagcccgaga tcctcgaccc ccagggccag        60
     gcggtgcagc gcgcactgcc tcgcatgggc ttcgactccg tcaccaacgt ccgccagggc       120
     aagcgcttcg agctggagct cgccgacgcc gacccggcca ccctgcgggc caccgccgag       180
     cagatggccg agaagctgct cgccaacacc gtgatcgagg acttcaaggt cacggtgctg       240
     cccgccgaca gctccgagaa cgcctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page