(data stored in ACNUC7421 zone)

EMBL: CP001700.PE288

CP001700.PE288       Location/Qualifiers
FT   CDS_pept        327015..327701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0290"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sma:SAV_4139 phosphoribosylformylglycinamidine
FT                   synthase subunit I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69243"
FT                   /db_xref="GOA:C7QJA1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA1"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ACU69243.1"
FT                   /translation="MPARIGVVTFPGTLDDRQALRAAAAVGAEPVALWHKDRDLHQVDA
FT                   VVLPGGFSYGDYLRAGAIARFSPVMDTIIDAARDGLPVLGICNGFQVLCETHLLEGAMI
FT                   RNGDLHFINRDVTLRIENNRTAWTSDYEDGAEAVIPIKNVDGRFVADEPTLDALEAEGR
FT                   VLARYVANPNGAARDIAGITNAAGNVVGLMPHPEYAIDDLTGPHPGPGTDGLPFFTSIL
FT                   KSLVSA"
     atgcccgcgc gcatcggcgt cgtcaccttc cccggcaccc tggacgaccg gcaggcgctg        60
     cgcgccgcgg cggccgtcgg cgccgagccg gtggcgctct ggcacaagga tcgggacctg       120
     caccaggtgg acgcggtcgt gctgcccggt ggcttctcct acggcgacta cctgcgcgcc       180
     ggcgccatcg cccggttctc cccggtgatg gacacgatca tcgacgcggc ccgggacggt       240
     ctgccggtcc tgggcatctg caacggcttc caggtgctgt gcgagacgca cctgctcgag       300
     ggcgcgatga tccgcaacgg cgatctgcac ttcatcaacc gcgacgtcac cctgcggatc       360
     gagaacaacc gcaccgcctg gacctcggac tacgaggacg gcgccgaggc ggtcatcccg       420
     atcaagaacg tcgacggccg cttcgtcgcc gacgagccca cgctcgacgc gctggaggcc       480
     gagggtcgag tgctggcccg gtacgtggcg aatccgaacg gcgccgcgcg cgacatcgcg       540
     ggcatcacca acgccgccgg caacgtcgtc ggcctgatgc cgcaccccga gtacgccatc       600
     gacgacctga ccggtcccca cccgggcccg ggcaccgacg gtctgccgtt cttcacctcg       660
     atcctcaaga gcttggtttc cgcatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page