(data stored in ACNUC7421 zone)

EMBL: CP001700.PE289

CP001700.PE289       Location/Qualifiers
FT   CDS_pept        327698..330061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0291"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sgr:SGR_3871 putative phosphoribosyl
FT                   formylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69244"
FT                   /db_xref="GOA:C7QJA2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA2"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACU69244.1"
FT                   /translation="MSNGNSSENVFDTTDVFVDTAVSFDTVAKAAQTPDVKQPFRELGM
FT                   TEDEYLRVREILGRRPSSSELAMYSVMWSEHCSYKSSRVHLKQFGEKAPKTAALLVGPG
FT                   ENAGVVDVGEGLAVTFKVESHNHPSYVEPYQGAATGVGGIVRDILTMGARPIAVMDPLR
FT                   FGPADAPDTARVLPGVVAGVGGYGNCLGVPNIGGEIVFDPCYLGNPLVNALCVGVMRAD
FT                   EIKLAKAPGPGNQVILFGARTGGDGIGGASVLASATFDEDGPAKRPSVQVGDPFMEKVL
FT                   IECCLEIFAADLVVGIQDLGAAGLTCSTTELAAAGTGGMDVRLDLAPLRDSTLTPEEVL
FT                   MSESQERMMAVVEPAKVEAFLAVCDKWDVTATALGEVTDTGRLRMWWHGEIIVDVPPRT
FT                   LAHEGPVYNRPFARPEWQDALQADAPTAERLKRPGNAEELRETLLRLVGSPNLADKTWA
FT                   VEQYDHRVQGNTVLGHGEDSGMVRLDAALPGTSLGVALSTDGNGRFAKLDPYQGAQLAL
FT                   AEAYRNVAATGAKPLAVTDCLNFGSPEDPDVMWQFAEACRGLADACLELGTPVTGGNVS
FT                   FYNQTGELNIHPTPVVGVLGVIDDVDRRTRSAFEREGEILLLLGDTRDEFGGSEWAHEV
FT                   HGHLGGLPPRLDLQREKVLGEVLIAGSRDGMLSAAHDLSDGGLAQAVVEGCLRGGHGAR
FT                   LVLPETDADGAALDPFVALFAESAGRALVAVPRSEELRFTDMCVARGLPVARVGVVDGD
FT                   VLEVQGQFTVPMAELRTAHEAPFRKLFGHSVVDA"
     atgagcaacg gcaactcctc cgagaacgtc ttcgacacca ccgatgtgtt cgttgacacg        60
     gcggtctcgt tcgacaccgt cgcgaaggcc gctcagaccc cggacgtgaa gcagccgttc       120
     cgcgaactgg gcatgaccga ggacgagtac ctgcgcgtcc gcgagatcct gggccgccgt       180
     cccagctcct cggagctggc catgtactcg gtcatgtggt ccgagcactg ctcctacaag       240
     tcctcccggg tgcacctgaa gcagttcggc gagaaggctc cgaagaccgc cgcgctgctg       300
     gtcggtcccg gcgagaacgc cggcgtcgtg gacgtcggcg agggcctggc cgtcaccttc       360
     aaggtcgagt cgcacaacca cccctcctac gtcgagccgt atcagggcgc ggcgaccggg       420
     gtcggcggca tcgtccgcga catcctgacc atgggcgccc gcccgatcgc ggtcatggac       480
     ccgctgcgct tcggcccggc cgacgccccg gacaccgcgc gggtgctgcc cggcgtggtg       540
     gccggcgtcg gcggctacgg caactgcctc ggcgtgccga acatcggcgg ggagatcgtc       600
     ttcgacccct gctacctggg caacccgctg gtcaacgcgc tgtgcgtggg ggtcatgcgg       660
     gccgacgaga tcaagctggc caaggcgccg ggcccgggca accaggtgat cctgttcggc       720
     gcccggaccg gcggcgacgg catcggcggc gcctcggtgc tggccagcgc caccttcgac       780
     gaggacggcc cggccaagcg gccctccgtc caggtcggcg acccgttcat ggagaaggtg       840
     ctcatcgagt gctgcctgga gatcttcgcg gccgacctgg tcgtgggcat ccaggacctg       900
     ggcgccgccg ggctcacctg ctccaccacc gagctggccg cggcgggcac cggcggcatg       960
     gacgtgcggc tggacctggc gccgctgcgc gactcgacgc tgacccctga ggaagtcctc      1020
     atgtcggagt cgcaggagcg gatgatggcc gtggtcgagc cggccaaggt cgaggcgttc      1080
     ctggcggtct gcgacaagtg ggacgtcacc gccaccgccc tcggcgaggt caccgacacc      1140
     ggccggctgc gcatgtggtg gcacggcgag atcatcgtgg acgtcccgcc gcggaccctg      1200
     gcgcacgagg gcccggtgta caaccggccg ttcgcgcggc cggagtggca ggacgcgctg      1260
     caggccgacg cgccgaccgc cgagcggctc aagcgcccgg gcaacgccga ggaactgcgc      1320
     gagacgctgc tccggctggt cggctcgccg aacctggccg acaagacctg ggccgtggag      1380
     cagtacgacc accgcgtgca gggcaacacc gtcctcgggc acggcgagga ctccgggatg      1440
     gtgcggctgg acgccgcgct gccgggcacc tcgctcggcg tggcgctgtc caccgacggc      1500
     aacggccggt tcgccaagct cgacccgtat cagggcgcgc agctggcgct ggccgaggcc      1560
     taccgcaacg tggccgccac cggcgccaag ccgctggccg tcaccgactg cctgaacttc      1620
     ggctcgccgg aggacccgga cgtcatgtgg cagttcgccg aggcctgccg cggtctggcc      1680
     gacgcctgcc tggagctggg gaccccggtc accggcggca acgtgtcgtt ctacaaccag      1740
     accggagagc tgaacatcca cccgaccccg gtggtcggcg tgctcggcgt gatcgatgac      1800
     gtcgaccgcc gcacccgcag cgccttcgag cgcgagggcg agatcctgct gctgctcggc      1860
     gacacccgcg acgagttcgg cggctcggag tgggcgcacg aggtccacgg ccacctcggc      1920
     ggcctgccgc cgcgcctgga cctgcagcgc gagaaggtgc tcggcgaggt gctgatcgcc      1980
     ggctcgcgcg acggcatgct ctcggcggcg cacgacctgt ccgacggcgg cctggcgcag      2040
     gcggtcgtcg agggctgcct gcgcggcggc cacggcgccc gcctggtcct gccggagacg      2100
     gacgcggacg gtgcagcgct ggaccccttc gtcgcgctgt tcgccgagtc ggcgggccgc      2160
     gcgctggtcg cggttccgcg cagcgaggag ctgcggttca ccgacatgtg cgtggcgcgc      2220
     gggctgcccg tggcgcgcgt gggcgtcgtg gacggcgacg ttctggaggt acaggggcag      2280
     ttcacggtgc cgatggccga gctgcggacg gcgcatgagg cgccgttccg gaagctgttc      2340
     gggcactcgg tggtggacgc ctag                                             2364
//

If you have problems or comments...

PBIL Back to PBIL home page