(data stored in ACNUC7421 zone)

EMBL: CP001700.PE29

CP001700.PE29        Location/Qualifiers
FT   CDS_pept        complement(29325..29969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0029"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mjl:Mjls_3025 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68984"
FT                   /db_xref="GOA:C7QFP5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACU68984.1"
FT                   /translation="MLATLLPFLIACTAVAAVPGQSTALIIRQSIRGGKRAGFATVLGN
FT                   ESGVFVWGCAAAFGFTALLAASEIAYDGMRVVGACVLVWFAVQSFRSARRMKQDEAAEE
FT                   TDELGGDARTKGPLWSYRAGLLTNLANPKAAIFAMSFLPQFVPAHAPKLPTMVLLAATW
FT                   AVYEVFYYSLYVWCVQRLRAFFSRREVRRRMEQISGTVMLGLAVRMVVENS"
     atgctggcaa ccctgctgcc cttcctcatc gcctgcacgg cggtcgccgc ggtccccgga        60
     cagagcacgg cgctgatcat ccgccagtcg atccgaggcg ggaagcgcgc cggcttcgcg       120
     accgtgctgg gcaacgagag cggcgtgttc gtctggggct gtgccgccgc cttcggcttc       180
     accgcgctgc tcgccgcctc cgagatcgcc tatgacggga tgcgtgtcgt cggcgcctgt       240
     gtgctggtgt ggttcgcggt ccagtccttc cggtccgccc gcaggatgaa gcaggacgaa       300
     gccgccgagg agaccgacga actcggcggc gacgcgcgga ccaagggccc gctgtggtcc       360
     taccgcgccg ggctgctgac gaacctggcg aatccgaagg cggcgatctt cgcgatgtcc       420
     ttcctgccgc agttcgtccc ggcgcacgcc ccgaagcttc cgacgatggt cctgctggcc       480
     gcgacctggg ccgtatacga ggtcttctac tactcgctct acgtctggtg cgtccagcgg       540
     ctgcgcgcgt tcttcagccg gcgcgaggtc cgccgccgca tggagcagat ctccggcacg       600
     gtcatgctgg gcctggccgt ccggatggtc gtcgagaaca gctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page