(data stored in ACNUC7421 zone)

EMBL: CP001700.PE290

CP001700.PE290       Location/Qualifiers
FT   CDS_pept        complement(330071..330865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC12006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69245"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69245.1"
FT                   /translation="MAWFVHLTPEKNSARVRRSGLSPISRSRSDDPRPGLYCTPLLADY
FT                   TLTYQWSREIKRWKSPRLAAVHFRIPDDTAVTVGYYGDAPKPVTAAQAVARFLSLSPEE
FT                   MRGYEVFLPRGVTAKEIRRIKSLERPIGWRYRPNAHGHRPCACPACLDRGEYRISRIRD
FT                   KSSYYDTSHLPPRQEVLEKLATTRDSAEIVTLLDQLRSRGQGDIFRVAHLADHPDPDVR
FT                   EALAYALCGFNKKAAAELLEKLRSDPLKDVREAAGADEDDDL"
     atggcctggt tcgtacatct gactccggag aagaactccg cgcgcgtccg ccgctccggc        60
     ctgtcgccga tcagccgctc gcgtagtgac gacccgcgcc ccggtctcta ctgcactccg       120
     ctcctagcgg actacacgtt gacctaccag tggtcccgcg agatcaagcg ctggaagtca       180
     ccgcggttgg cagccgtgca cttccggata ccggacgaca ccgcggtaac cgttggctac       240
     tacggcgacg cgcccaagcc ggtgactgcg gcgcaggcag tagcgcgctt cctgtcgctg       300
     tcccctgagg agatgcgcgg atacgaagtg ttcctccccc gcggtgtcac cgccaaggag       360
     atccggcgta tcaagtcttt agagcgcccc atcggctggc gctatcggcc gaacgctcac       420
     gggcaccggc cctgcgcgtg ccctgcctgc ctggaccgag gcgagtatcg gatctcccgc       480
     atccgcgaca agtcttcgta ctacgacaca agccacctcc cgccccgcca agaagtgctg       540
     gagaagctgg ccaccacacg ggacagcgcg gagatcgtca cactcctcga ccaactccgc       600
     agccgcggcc aaggcgacat cttccgagtc gcgcacctgg ccgaccaccc ggatcccgac       660
     gtccgcgaag cactcgccta cgcgctgtgc ggcttcaaca aaaaagccgc cgcggagctt       720
     ctggagaagc tccgcagcga cccgctcaag gacgtccgcg aggccgccgg agcagacgag       780
     gacgacgacc tttag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page