(data stored in ACNUC7421 zone)

EMBL: CP001700.PE292

CP001700.PE292       Location/Qualifiers
FT   CDS_pept        complement(331843..332277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0294"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="KEGG: met:M446_6942 chromosome segregation protein
FT                   SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69247"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA5"
FT                   /inference="similar to AA sequence:KEGG:M446_6942"
FT                   /protein_id="ACU69247.1"
FT                   /translation="MITAQTPASAPTDDAGRTPERAAMAGAIDAQARRMDQLSAAIVRA
FT                   TSQVTWSGRAAERFRARAAERSRECLQLAVALRASAERVHAAETARPAATHAGQAPADE
FT                   KSGHAAVVGAISGMAGTKIPGVAGGGVGGARPSSESGPAR"
     gtgatcaccg cccagacccc cgcctcagcc cccaccgacg acgccggccg gacccccgag        60
     cgcgccgcga tggccggtgc gatcgacgcc caggcgcgcc ggatggacca gttgtccgcc       120
     gcgatcgtgc gtgcgacctc gcaggtgacg tggtccggcc gggcagccga gcgattccgg       180
     gcgcgcgcgg cggaacggtc gcgagagtgc ctgcagctgg cggtggcgct gcgcgcctcg       240
     gcggagcggg tgcacgccgc ggagacagcg cggccggcgg cgacgcacgc gggccaggct       300
     ccggcggacg agaagagcgg tcacgcggca gttgtcggcg cgatcagcgg tatggcaggc       360
     accaagatcc ctggcgtggc cggcggcggt gtgggcggtg cccgaccgag cagcgagtcc       420
     ggaccggcgc gatga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page