(data stored in ACNUC7421 zone)

EMBL: CP001700.PE293

CP001700.PE293       Location/Qualifiers
FT   CDS_pept        332467..333234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69248"
FT                   /db_xref="GOA:C7QJA6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA6"
FT                   /inference="similar to AA sequence:KEGG:SAV_4137"
FT                   /protein_id="ACU69248.1"
FT                   /translation="MPKTRRPASAKVRQAVVNQWQAHVGYAAALTAEQLAAPSKLAGWD
FT                   VKTLVGHVAFTVRTVVTRAAEPVAGDQAEVYDWLTATPTASAAVDAGTRELVEDGVVLA
FT                   DEVTEAEKLMERYGDEDLIAMRFGPMRFDDFLVSRIVEATVHADDLERSTGIEFPHDRE
FT                   ALAITVRQLADAMAAKVPGNSVELRVPPFAAVQCVPGPRHTRGTPPNVVEMTPRTWIRL
FT                   AAGRMTWDEAMDQALVSASGQRADLKEFLPLMG"
     atgccgaaga cccgccgccc cgcctccgcc aaggtccgcc aagccgtcgt gaaccagtgg        60
     caggcccatg tcggctacgc cgccgccctg accgccgagc agctcgcggc gccgtcgaag       120
     ctcgccggct gggacgtgaa gacgctggtc gggcacgtcg ccttcacggt gcgcacggtc       180
     gtgacccggg ccgccgagcc ggtcgccggg gaccaggccg aggtctacga ctggctgacc       240
     gcgaccccga ccgccagcgc cgcggtcgac gccgggaccc gcgagctggt ggaggacggc       300
     gtggtcctgg ccgacgaggt gaccgaggcc gagaagctca tggagcgcta cggcgacgag       360
     gacctgatcg ccatgcgctt cgggcccatg cgcttcgacg acttcctggt ctcgcgcatc       420
     gtggaggcca cggtgcacgc cgacgacctg gagcggtcca ccgggatcga gttcccgcac       480
     gaccgggagg cgctggcgat caccgtccgg cagctggccg acgccatggc ggccaaggtc       540
     ccgggcaact cggtggagct gcgggtcccg ccgttcgccg ccgtgcagtg cgtcccgggt       600
     ccgcgccaca cgcggggcac gccgccgaac gtggtcgaga tgacgccgcg gacctggatc       660
     cggctcgccg cgggccggat gacctgggac gaggcgatgg accaggcgct ggtgtcggcg       720
     tcggggcagc gggcggacct gaaggagttc ctgccgctca tggggtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page