(data stored in ACNUC7421 zone)

EMBL: CP001700.PE294

CP001700.PE294       Location/Qualifiers
FT   CDS_pept        333393..334910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0296"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: nca:Noca_4316
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69249"
FT                   /db_xref="GOA:C7QJA7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA7"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACU69249.1"
FT                   /translation="MIHPSGFRPGDGRLTHELDPQDTGPQDACGVFGVWAPGEEVAKLA
FT                   YFGLYALQHRGQESAGIAVSNGKQILVYKDMGLVSQVFDEATLQSLQGYLAIGHARYST
FT                   TGSSVWENAQPTFRATAHGAVALGHNGNLTNTGELARLAAERRTTSGAGDKHAMTSDTG
FT                   LMTELLASYSDRSLEDAAAEVLPQLRGAFSLVFMDETTLYAARDPQGVRPLMLGRLDRG
FT                   WVVASEQAALDTVGASFIREIEPGELIAVDENGLRSRHFAEPQPKGCVFEYVYLARPDA
FT                   TISGRNVHAARVEMGRTLAREAPVEADLVIATPESGTPAAIGFAEESGIPFGQGFVKNA
FT                   YVGRTFIQPSQTLRQLGVRLKLNALREVIEGKRLVVVDDSIVRGNTQRAVSKMLREAGA
FT                   TEVHLRISSPPVKWPCFYGIDFATRAELIANGLNTDEIAKSIGADSLAYITLDGMTAAT
FT                   HQPADRLCRACFDGVYPIALPEDELLGKHLLEISVDPLAHTDALSRP"
     gtgatccacc cttccggctt ccgccccggc gatggcagac tcacccacga actcgacccc        60
     caggacaccg gcccgcagga cgcctgcgga gtcttcggcg tctgggctcc cggcgaagaa       120
     gtcgcgaagc tcgcgtactt cggcctgtac gcgctgcagc accgcggcca ggaatccgcc       180
     ggcatcgccg tgtccaacgg caagcagatc ctggtctaca aggacatggg cctggtctcc       240
     caggtcttcg acgaggccac cctgcagtcc ctgcagggct acctggcgat cggccacgcg       300
     cgctactcca ccaccggctc ctcggtgtgg gagaacgcgc agccgacctt ccgggccacc       360
     gcgcacggcg ccgtggccct cggccacaac ggcaacctga ccaacaccgg cgagctggcc       420
     cggctggccg ccgagcggcg gaccacgtcc ggcgccggcg acaagcacgc catgacctcg       480
     gacaccgggc tgatgaccga gctgctggcg tcctactccg accgctccct ggaggacgcg       540
     gccgccgagg tgctgccgca gctgcgcggc gccttctccc tggtgttcat ggacgagacc       600
     acgctctacg cggcgcgcga cccgcagggt gtgcggccgc tgatgctcgg ccgcctggac       660
     cgcggctggg tggtggcctc cgagcaggcg gcgctggaca ccgtcggcgc gagcttcatc       720
     cgcgagatcg agcccggcga gctgatcgcc gtcgacgaga acggcctgcg ctcccggcac       780
     ttcgccgagc cccagcccaa gggctgtgtc ttcgagtacg tctacctggc gcgccccgac       840
     gccaccatct ccggccgcaa cgtgcacgcc gcgcgcgtgg agatgggccg caccctggcc       900
     cgcgaggcgc cggtggaggc cgacctggtc atcgccacgc cggagtccgg caccccggcc       960
     gcgatcggct tcgccgagga gtccggcatc cccttcggcc agggcttcgt gaagaacgcc      1020
     tacgtcgggc gcaccttcat ccagcccagc cagacgctgc gccagctcgg cgtgcggctg      1080
     aagctgaacg cgctgcgcga ggtcatcgag ggcaagcgcc tggtcgtggt ggacgactcg      1140
     atcgtgcgcg gcaacaccca gcgcgcggtg tccaagatgc tgcgcgaggc cggcgccacc      1200
     gaggtccacc tgcggatctc ctccccgccg gtgaagtggc cgtgtttcta cggcatcgac      1260
     ttcgccaccc gcgccgagct gatcgccaac ggcctgaaca ccgacgagat cgccaagtcg      1320
     atcggcgccg actcgctggc ctacatcacc ctggacggca tgaccgcggc cacgcaccag      1380
     ccggccgacc ggctgtgccg cgcctgcttc gacggcgtgt acccgatcgc gctgcccgag      1440
     gacgagctgc tgggcaagca tctcctggag atctcggtcg acccgctggc ccacaccgac      1500
     gccctgtcgc gcccgtag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page