(data stored in ACNUC7421 zone)

EMBL: CP001700.PE295

CP001700.PE295       Location/Qualifiers
FT   CDS_pept        334959..336044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0297"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: sgr:SGR_3878 putative
FT                   phosphoribosylaminoimidazole synthetase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo- ligase; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69250"
FT                   /db_xref="GOA:C7QJA8"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA8"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ACU69250.1"
FT                   /translation="MSGATYAAAGVDIEAGDRAVELMKEWVAKTRRPEVLGGIGGFAGL
FT                   FDASALKAYDRPLLATSTDGVGTKVAIAQRMDRHDTIGRDLVGMVVDDLVVCGAEPLFM
FT                   TDYIATGKVVPEVIAGIVKGIAEGCVLAGCALVGGETAEHPGLLKPGEYDVAGAGTGVV
FT                   EADKVLGAERVREGDVLVAMASSGAHSNGYSLLRHVFFDVAGWELDRDVPEFGRTLGEE
FT                   LLEPTRIYSLDCLALIEAAEVHAISHITGGGVAANIARIIPAGLEARLDRGTWTPPAVF
FT                   GTVGALGGVATLELEKTLNMGVGMVAVLPAASVDPALALLNARGLPSWVCGEVVASEGA
FT                   VTVGGAKGGDGAASLHGDYAG"
     atgtctggag ccacctacgc cgcggccggc gtcgacatcg aggccggcga ccgcgcggtc        60
     gagctgatga aggagtgggt cgccaagacc cggcgcccgg aggtcctcgg cggcatcggc       120
     ggtttcgcgg gcctgttcga cgcctcggcg ctgaaggcgt acgaccggcc gctgctggcc       180
     acctcgaccg acggcgtggg caccaaggtc gcgatcgcgc agcggatgga ccggcacgac       240
     accatcggcc gcgacctggt cggcatggtc gtggacgacc tggtggtctg cggcgccgag       300
     ccgttgttca tgaccgacta catcgccacc ggcaaggtcg tgcccgaggt gatcgccggg       360
     atcgtcaagg gcatcgccga gggctgtgtg ctcgccggct gcgcgctggt cggcggcgag       420
     acggcggagc acccgggcct gctcaagccg ggtgagtacg acgtggccgg cgccgggacc       480
     ggcgtggtcg aggccgacaa ggtgctcggc gccgagcggg tccgcgaggg cgacgtgctg       540
     gtcgcgatgg cctcctccgg cgcgcactcc aacgggtact cgctgctgcg gcatgtgttc       600
     ttcgacgtcg cgggctggga gctggaccgc gacgtgccgg agttcggccg cacgctcggc       660
     gaggagctgc tggagccgac ccggatctac tcgctggact gcctggcgct gatcgaggcc       720
     gccgaggtgc acgcgatctc gcacatcacc ggcggcggcg tggcggcgaa catcgctcgc       780
     atcatcccgg cgggcctgga ggcgcggctg gaccgcggca cctggacccc gccggcggtg       840
     ttcggcacgg tcggcgcgct cggcggcgtc gcgacgctgg agctggagaa gacgctgaac       900
     atgggcgtcg ggatggtcgc ggtgctgccg gccgcctccg tcgacccggc gctggcgctg       960
     ctgaacgcgc gcgggctgcc gagctgggtg tgcggcgagg tcgtggcctc cgagggcgcg      1020
     gtgacggtcg gcggcgcgaa gggcggcgac ggcgcggcgt ccctgcacgg cgactacgcc      1080
     gggtag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page