(data stored in ACNUC7421 zone)

EMBL: CP001700.PE296

CP001700.PE296       Location/Qualifiers
FT   CDS_pept        complement(336315..336587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69251"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA9"
FT                   /inference="similar to AA sequence:KEGG:SCO4088"
FT                   /protein_id="ACU69251.1"
FT                   /translation="MGRGRAKAKQTRVARDLKYRDVRTDLTQLQRELQQDGVHTSNGHS
FT                   AEAPSQQDDDADDDELYAKYADDDGDDDYDSADDGGAHRSHHRRS"
     atggggcgcg gccgggccaa ggccaagcag acgcgggtcg cccgagacct gaagtatcgc        60
     gacgtccgca ccgatctgac gcagcttcag cgtgagctgc agcaagacgg tgtgcacacg       120
     tccaacgggc attccgccga ggcaccgtcg cagcaggacg acgacgcgga cgacgatgag       180
     ttgtacgcga agtacgccga cgatgacggc gatgacgact acgacagcgc ggacgacggc       240
     ggtgcacacc gcagtcacca ccgccgcagt tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page