(data stored in ACNUC7421 zone)

EMBL: CP001700.PE297

CP001700.PE297       Location/Qualifiers
FT   CDS_pept        complement(336830..337918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0299"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; Glu/Leu/Phe/Val dehydrogenase; KEGG: saq:Sare_0168
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69252"
FT                   /db_xref="GOA:C7QJB0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB0"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ACU69252.1"
FT                   /translation="MSDKPDNDVSEVFASDHEQVVYCRDEETGLKAIIAVHNTLLGPGL
FT                   GGTRFFPYATEQDALKDVLRLSRGMSYKNALAGLDLGGGKAVIIGDPSEIKTEALLRAY
FT                   GRFVQSLNGRYYTACDVGTYVQDMDVVAKESRFVTGRSMESGGAGDSSVLTAYGVFQGM
FT                   RASAEYLWGSPSLAGKRVGISGVGKVGRYLIGHLIEDGASIVATDPYEGAIQWLRDNYA
FT                   QVELVSTTEDLIAADIDVYAPCALGGALDDATVAALTAKIVCGAANNQLAHTGVEKQLE
FT                   ARGILYAPDYLVNSGGVIQVADEIHGFDFERAKRRASGIFDTTMRIYSLASEEGVPPSV
FT                   AADRLAERRMRDVGRLRGVYLP"
     gtgtctgaca agcctgacaa cgacgtcagc gaggtattcg ccagcgacca cgagcaagtg        60
     gtgtactgcc gcgacgaaga gaccggcctg aaggccatca tcgcggttca caacaccctg       120
     ctcggtcctg ggctcggcgg tactcgcttc ttcccctacg ccaccgagca ggacgcgctg       180
     aaggacgtcc tgcgcctgtc gcggggcatg tcgtacaaga acgccctcgc cggtctggac       240
     ctcggcggcg gcaaggccgt catcatcggc gacccgagcg agatcaagac cgaggcgctg       300
     ctgcgcgcct acggccgctt cgtgcagtcc ctcaacggcc gctactacac cgcgtgcgac       360
     gtcggcacct acgtgcagga catggacgtg gtcgccaagg agtcccggtt cgtcaccggc       420
     cgctccatgg agtccggcgg cgcgggcgac tcctccgtgc tcaccgccta cggcgtcttc       480
     cagggcatgc gcgcctccgc cgagtacctg tggggctcgc cctcgctggc cggcaagcgg       540
     gtcggcatct ccggcgtcgg caaggtcggc cgctacctga tcgggcacct gatcgaggac       600
     ggcgcctcga tcgtggccac cgacccgtac gagggcgcga tccagtggct gcgcgacaac       660
     tacgcgcagg tcgagctggt ctccaccacc gaggacctga tcgcggccga catagacgtc       720
     tacgccccgt gcgccctcgg cggcgccctg gacgacgcca ccgtcgccgc cctcaccgcc       780
     aagatcgtct gcggcgccgc caacaaccag ctcgcgcaca ccggcgtgga gaagcagctg       840
     gaagcccgcg gcatcctcta cgcccccgac tacctggtga actccggcgg tgtgatccag       900
     gtcgcagacg agatccacgg cttcgacttc gaacgcgcca agcgccgcgc ctcgggcatt       960
     ttcgacacga cgatgcggat ctactccctg gcctcggagg agggcgttcc cccgtctgtg      1020
     gccgccgacc ggctcgccga gaggcgtatg cgggacgtcg gccgactgcg cggcgtatac      1080
     ctgccgtag                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page