(data stored in ACNUC7421 zone)

EMBL: CP001700.PE298

CP001700.PE298       Location/Qualifiers
FT   CDS_pept        338165..339100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69253"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB1"
FT                   /inference="similar to AA sequence:KEGG:SCO4090"
FT                   /protein_id="ACU69253.1"
FT                   /translation="MRASPGGAIPAPYMAYLRVYEPLAAFPAGERAEWEAWLLRNPEPK
FT                   SLAEEQSASLRGLVAVPPIAVPENESRVAYVLDNGETTLLCPWQSRLRSWLALTELRAV
FT                   HGDGGVRLFWPRGVLERADSEYERWWAEDPEALPHILTASWQVPIRWLVLFGLEDAVTD
FT                   ADGPGDRSDRGDRGEAGEGDEKVAAVTLQFRTAMSQARKRCARALRVLKRSLGAGPLVE
FT                   AVETLGMWLEEFHPHSVVELDYGGLMGLLVAQGALGAEERVDGIVLDCSVRYVADGLAA
FT                   LAQGDDTGVTAAYLRYRAKWDAVRVLARAN"
     gtgcgcgcat cccccggcgg cgcgattccg gcgccctaca tggcctacct gcgggtctat        60
     gaaccgctgg ccgcgtttcc ggctggggag cgcgccgagt gggaagcctg gctgctgcgg       120
     aacccggagc ccaagagcct cgccgaggag cagagcgcgt cgctgcgcgg gctggtggcg       180
     gttcccccga tcgccgtgcc ggagaacgag tcccgggtcg cctatgtgct cgacaacggt       240
     gagacgaccc tgctgtgtcc atggcagtcg cggctgcggt cctggctggc gctgaccgaa       300
     ctgcgcgcgg tccacggcga cggcggcgtc cggctgttct ggccgcgggg cgtcctggaa       360
     cgcgccgaca gcgaatacga gcggtggtgg gccgaggacc cggaggcgct gccgcacatc       420
     ctgaccgcgt cctggcaggt gccgatccgc tggctcgtcc tgttcggcct ggaggacgcg       480
     gtgaccgatg cggacggtcc cggcgaccgg agcgatcgcg gcgaccgcgg cgaggccggc       540
     gagggcgacg agaaggtcgc cgccgtcacc ctccagttcc gcaccgcgat gagccaggcg       600
     cgcaagcgct gtgccagggc gctgcgagtc ctcaagcggt ctctgggggc gggaccgctt       660
     gtggaggccg tggagacgct gggaatgtgg ctggaggagt tccacccgca ctcggtcgtc       720
     gaactcgatt acgggggtct gatggggttg ctggtggccc agggcgcctt gggcgccgag       780
     gagcgggtgg acggaatcgt cctggactgc tccgtccgtt atgtggcaga cggtctcgcc       840
     gccctggctc agggtgacga taccggggtc accgccgcgt atctgcggta tcgcgccaag       900
     tgggacgccg tccgggtgct cgcccgggcg aactga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page